[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69590.1


[Show Plain Result]

## Summary of Sequence Search
   1::419
   1::416  2.9e-17 22.8% 0052032 00520321 1/1   AD(P)-binding domain                    
   1::416  2.3e-16 24.5% 0036092 00360921 1/1   AD(P)-binding domain                    
   1::416  2.2e-15 23.3% 0041341 00413411 1/1   AD(P)-binding domain                    
   1::419  3.9e-15 20.7% 0043577 00435771 1/1   AD(P)-binding domain                    
   1::414  1.8e-14 20.2% 0047022 00470221 1/1   AD(P)-binding domain                    
   1::418  6.4e-14 27.3% 0036300 00363001 1/1   AD(P)-binding domain                    
   1::341  1.5e-13 26.5% 0052313 00523131 1/1   AD(P)-binding domain                    
   1::417  3.9e-13 24.3% 0046270 00462701 1/1   AD(P)-binding domain                    
   1::418  4.2e-13 24.6% 0048494 00484941 1/1   AD(P)-binding domain                    
   1::419    7e-13 24.5% 0040602 00406021 1/1   AD(P)-binding domain                    
   1::421    7e-13 23.9% 0046514 00465141 1/1   AD(P)-binding domain                    
   1::417  9.8e-13 24.3% 0049003 00490031 1/1   AD(P)-binding domain                    
   1::417  1.2e-12 25.0% 0052926 00529261 1/1   AD(P)-binding domain                    
   1::414  1.3e-12 22.4% 0037441 00374411 1/1   AD(P)-binding domain                    
   2::421  1.4e-12 27.2% 0037643 00376431 1/1   AD(P)-binding domain                    
   1::417  4.5e-12 23.3% 0049150 00491501 1/1   AD(P)-binding domain                    
   1::413  5.3e-12 21.5% 0046834 00468341 1/1   AD(P)-binding domain                    
   1::419  7.2e-12 25.9% 0040688 00406881 1/1   AD(P)-binding domain                    
   1::418  1.1e-11 28.1% 0044098 00440981 1/1   AD(P)-binding domain                    
   1::418  1.1e-11 22.6% 0050148 00501481 1/1   AD(P)-binding domain                    
   1::333    3e-11 22.7% 0047682 00476821 1/1   AD(P)-binding domain                    
   1::420  3.7e-11 23.4% 0047133 00471331 1/1   AD(P)-binding domain                    
   2::415  9.4e-11 25.2% 0048771 00487711 1/1   AD(P)-binding domain                    
   1::413  1.5e-10 20.7% 0047712 00477121 1/1   AD(P)-binding domain                    
   1::421  1.8e-10 26.9% 0047270 00472701 1/1   AD(P)-binding domain                    
   1::360  3.2e-10 22.7% 0049222 00492221 1/1   AD(P)-binding domain                    
   3::414  3.7e-10 23.8% 0045881 00458811 1/1   AD(P)-binding domain                    
   1::421  4.4e-10 25.1% 0053321 00533211 1/1   AD(P)-binding domain                    
   1::380  6.2e-10 24.7% 0048356 00483561 1/1   AD(P)-binding domain                    
   1::392  8.3e-10 22.1% 0040660 00406601 1/1   AD(P)-binding domain                    
   1::420  2.2e-09 19.1% 0046760 00467601 1/1   AD(P)-binding domain                    
   1::355  3.5e-09 20.7% 0046579 00465791 1/1   AD(P)-binding domain                    
   1::417  5.7e-09 25.1% 0045797 00457971 1/1   AD(P)-binding domain                    
   1::419  8.9e-09 22.8% 0048199 00481991 1/1   AD(P)-binding domain                    
   1::313    7e-08 27.4% 0050363 00503631 1/1   AD(P)-binding domain                    
 257::420    1e-07 21.7% 0045870 00458702 2/2   AD(P)-binding domain                    
   1::34   1.2e-07 41.2% 0046274 00462741 1/1   AD(P)-binding domain                    
   1::417  1.6e-07 21.7% 0046057 00460571 1/1   otide-binding domain                    
   1::416  2.1e-07 22.6% 0047029 00470291 1/1   AD(P)-binding domain                    
   1::37   2.2e-07 40.5% 0039664 00396641 1/2   AD(P)-binding domain                    
   3::418  3.1e-07 21.3% 0048364 00483641 1/1   AD(P)-binding domain                    
   1::419    5e-07 23.5% 0046128 00461281 1/1   AD(P)-binding domain                    
 255::417  5.4e-07 27.3% 0035989 00359892 2/2   AD(P)-binding domain                    
   1::34   7.4e-07 44.1% 0040049 00400491 1/2   AD(P)-binding domain                    
   1::34   8.7e-07 41.2% 0040035 00400351 1/2   AD(P)-binding domain                    
   1::34   9.6e-07 42.4% 0035989 00359891 1/2   AD(P)-binding domain                    
   1::34   9.8e-07 41.2% 0046446 00464461 1/2   AD(P)-binding domain                    
   1::417  1.1e-06 27.1% 0036459 00364591 1/1   otide-binding domain                    
   1::34   1.3e-06 38.2% 0048583 00485831 1/1   AD(P)-binding domain                    
   1::35   1.5e-06 37.1% 0038074 00380741 1/2   AD(P)-binding domain                    
   1::34   1.5e-06 33.3% 0047327 00473271 1/1   otide-binding domain                    
 212::418  1.6e-06 21.5% 0040035 00400352 2/2   AD(P)-binding domain                    
   3::362  1.7e-06 21.8% 0045795 00457951 1/1   otide-binding domain                    
   1::310  1.8e-06 25.8% 0036889 00368891 1/1   AD(P)-binding domain                    
   1::34   2.2e-06 38.2% 0047564 00475641 1/1   AD(P)-binding domain                    
   3::421  3.4e-06 24.5% 0050927 00509271 1/1   AD(P)-binding domain                    
   1::34   4.1e-06 41.2% 0045518 00455181 1/2   AD(P)-binding domain                    
   1::34   5.2e-06 32.4% 0044413 00444131 1/2   AD(P)-binding domain                    
 262::413  5.6e-06 28.2% 0039664 00396642 2/2   AD(P)-binding domain                    
   1::312  1.1e-05 26.0% 0048045 00480451 1/1   AD(P)-binding domain                    
   3::327  1.7e-05 23.6% 0048607 00486071 1/1   AD(P)-binding domain                    
   1::351  2.9e-05 25.5% 0046750 00467501 1/1   AD(P)-binding domain                    
   1::312  3.2e-05 27.6% 0038449 00384491 1/1   AD(P)-binding domain                    
   1::34   3.9e-05 41.2% 0046416 00464161 1/2   AD(P)-binding domain                    
   1::312  4.4e-05 24.7% 0048866 00488661 1/1   AD(P)-binding domain                    
   3::34   5.7e-05 37.5% 0045870 00458701 1/2   AD(P)-binding domain                    
   1::312  6.4e-05 25.3% 0048009 00480091 1/1   AD(P)-binding domain                    
   1::31   6.9e-05 35.5% 0052911 00529111 1/1   AD(P)-binding domain                    
   1::34   8.1e-05 35.3% 0052600 00526001 1/2   AD(P)-binding domain                    
   2::34   8.1e-05 33.3% 0049990 00499901 1/2   otide-binding domain                    
   1::314  8.7e-05 25.3% 0048807 00488071 1/1   otide-binding domain                    
 253::421    9e-05 28.5% 0045518 00455182 2/2   AD(P)-binding domain                    
   1::312  0.00013 25.3% 0053322 00533221 1/1   AD(P)-binding domain                    
   1::34   0.00018 32.4% 0047141 00471411 1/1   otide-binding domain                    
   1::313   0.0002 27.5% 0050961 00509611 1/1   AD(P)-binding domain                    
   1::34   0.00021 35.3% 0047068 00470681 1/1   AD(P)-binding domain                    
   1::34   0.00025 44.1% 0048865 00488651 1/1   AD(P)-binding domain                    
 253::417  0.00027 27.8% 0040049 00400492 2/2   AD(P)-binding domain                    
   2::100  0.00029 22.3% 0046156 00461561 1/1   otide-binding domain                    
   1::310  0.00033 23.7% 0047565 00475651 1/1   AD(P)-binding domain                    
   1::34   0.00041 35.3% 0052963 00529631 1/1   AD(P)-binding domain                    
 255::415   0.0016 22.6% 0046446 00464462 2/2   AD(P)-binding domain                    
 257::419   0.0018 26.2% 0046416 00464162 2/2   AD(P)-binding domain                    
 257::421     0.01 19.1% 0052600 00526002 2/2   AD(P)-binding domain                    
 203::421    0.018 21.5% 0038074 00380742 2/2   AD(P)-binding domain                    
 257::314      1.4 25.0% 0044413 00444132 2/2   AD(P)-binding domain                    
 257::417      2.8 25.0% 0049990 00499902 2/2   otide-binding domain                    
   1::419


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
00520321   1/1  MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlvlEkgpllggtsglngggihaglskllldl........
00360921   1/1  pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlErgGrlasgripgklldggahllpglleellag
00413411   1/1  MpmsseeyDvvViGaGpaGlaaAlrlaraGlkVlllEkgpvlgGtssrnqggirldlgaipl....dlle
00435771   1/1  M.kdVaviGAGiaGlaaAyeLaraGlkVtvlEard...................................
00470221   1/1  m.yDVvviGgGiaGlaaAlrLaraGlkVlvlEagdrlGGrlrtvrlgggtsldlggivfpgl.ypallel
00363001   1/1  mekydvvviGaGlaGlsaAlelaragldvtvlerg...................................
00523131   1/1  msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlggascrnsggglakgllleelpal.........
00462701   1/1  MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlllEkgd..............
00484941   1/1  aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlGGrsrtggypgfpiidsgallf.........
00406021   1/1  MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllgggllnag.............dildk
00465141   1/1  eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgpr.................................
00490031   1/1  lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVlllEkgprlggtsclnggglppggl
00529261   1/1  lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkg
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLaraGlkVtvlEardrlGGrlr
00376431   1/1  -eydvvvvGaGpaGlaaAlalaraglkvlllekgprlggllvglipsklll...................
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGlkVtvlEardrl....
00468341   1/1  smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprp.......................
00406881   1/1  MsskeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlgglllagcipgkallaaalllrllellael
00440981   1/1  MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllntgcgp....................
00501481   1/1  lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglllyvgcilskall..........
00476821   1/1  lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae.GlkVlvlEaggrlggrgatpsg
00471331   1/1  tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyktllalGgllltvglipgkallgaall...
00487711   1/1  -kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgrnagllhaglaylelarlaresldl
00477121   1/1  ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggtalgrggalsprgl.................
00472701   1/1  ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierglGgtllnggpglskpll.......
00492221   1/1  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgd...
00458811   1/1  --llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrdrlGGtsnggdgrldlgahvfflllppgl
00533211   1/1  mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrlnggggaaldlpsklllrlldll....
00483561   1/1  MskkydvviiGaGiaGlsaAlrLaraGlkVlllEkgdrlGGtsgrnaglipgglrldaall.........
00406601   1/1  MddlpeeyDVvViGaGlaGlaaAaaLaraGlrVlvlEkrdrlGGtsatsrypGfrfdvggsllpgtipg.
00467601   1/1  MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtllllggtclnvg..............c
00465791   1/1  mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgrgasgrnaggia..................
00457971   1/1  sekydvviiGaGpaGlaaAlrlarlaglkvlliekgrlgglllllayggil...................
00481991   1/1  klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarlGlkvll
00503631   1/1  masmsmkydvvIiGaGpaGlaaAlrLaraGlkvtvlEkgprlGgtwrt......................
00458702   2/2  ----------------------------------------------------------------------
00462741   1/1  mlMkkkyDviiiGaGpaGlaaAleLaraGlkVlv------------------------------------
00460571   1/1  pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggtsgtnggllaaglvapllllpggipll
00470291   1/1  lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLaelaGlkVlvlEa.........GGtar
00396641   1/2  MsylasaallaalpslletieyDVlviGgGpaGlsaA---------------------------------
00483641   1/1  --ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcllskalg...................
00461281   1/1  glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVlvlEagdrlgGascipsgaglgadlg
00359892   2/2  ----------------------------------------------------------------------
00400491   1/2  MkdleyDvvvvGaGpaGlaaAlalaragpdlkva------------------------------------
00400351   1/2  MeyDvvvvGaGpaGlaaAlrLaraGlkVlvlErg------------------------------------
00359891   1/2  MkeldeeyDvviiGaGpaGlsaAlrLaraG.kVl------------------------------------
00464461   1/2  MmplslllatalelplpalaldkkyDvvViGaGp------------------------------------
00364591   1/1  mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalar
00485831   1/1  lsedkeyDVvviGgGpaGlaaAlalaraGlkVll------------------------------------
00380741   1/2  keydvvviGgGpaGlaaAlrlaraGlkvlllekgd-----------------------------------
00473271   1/1  M.yDviviGaGiaGlaaAyrLakaGlkVlvlEkg------------------------------------
00400352   2/2  ----------------------------------------------------------------------
00457951   1/1  --yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlGGtsglnaglippglggplddrglala
00368891   1/1  ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlgglld........
00475641   1/1  lldkeyDVvviGgGpaGlaaAlrlaraGlkvlll------------------------------------
00509271   1/1  --vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtil........................
00455181   1/2  MseydvvviGgGpaGlaaAlrlaeaGlkvlvlEk------------------------------------
00444131   1/2  MsdedyDviviGaGiaGlvaAarLakaGlkVlvl------------------------------------
00396642   2/2  ----------------------------------------------------------------------
00480451   1/1  pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlgglld.........
00486071   1/1  --myDvviiGaGpaGlaaAlrLaraGlkVlvlEk.drlGGtc............................
00467501   1/1  kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlggtpl..........................
00384491   1/1  lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvver.drlggtl...........
00464161   1/2  MleydvvviGgGpaGlaaAlrlaraGlkvlliek------------------------------------
00488661   1/1  srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgakvtlvergdrl
00458701   1/2  --ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEa------------------------------------
00480091   1/1  ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld........
00529111   1/1  llsnlplgrllpfllptslwldtlplpllel---------------------------------------
00526001   1/2  MseeyDvvvvGaGpaGltaAleLaraGlkVlllE------------------------------------
00499901   1/2  -kkdvvviGAGiaGlaaAlrLaeaGhkVtvlEar------------------------------------
00488071   1/1  irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalaraGlkVt
00455182   2/2  ----------------------------------------------------------------------
00533221   1/1  ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld........
00471411   1/1  mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvl------------------------------------
00509611   1/1  lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglkVtliergdrlggl
00470681   1/1  lllllmmmlhydvvviGgGpAGlaaAlrlarldp------------------------------------
00488651   1/1  mlpkdvviiGgGpaGleaalalarlglklevtli------------------------------------
00400492   2/2  ----------------------------------------------------------------------
00461561   1/1  -gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvp.....ggllrygiapdfrlpkelldrliell
00475651   1/1  pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvvereprlggtld.......
00529631   1/1  mptkkdVaiIGAGpaGLaaAllLaraGhdldVtv------------------------------------
00464462   2/2  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00526002   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00444132   2/2  ----------------------------------------------------------------------
00499902   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           APEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
00520321   1/1  ......................................................................
00360921   1/1  lgdlaellalkpelvalledgaailllprgvrllaglglggssainagvylrvspadfdelgawgvtldd
00413411   1/1  elgldlvkggdgltleagalvlatgarpripplpglgvpgvltsdgalalrepgkrvvviggglsglel.
00435771   1/1  ...........................................rlGGrsrtvgy..pgfrl.dlgaglip
00470221   1/1  leelglelallaldgellayldglvlelgidlntlvvaldpdalevlledleelradavvlAtGsrprlp
00363001   1/1  ......................................................................
00523131   1/1  ......................................................................
00462701   1/1  .......................................rlGGtslrsggilldgglrllegl..glldr
00484941   1/1  ............................pellpyllellkelglelrl.........pdlggrvvvlpdg
00406021   1/1  lgllaallvrladalvlatgarprrlgipglelp......ggrvvvigggviale...............
00465141   1/1  .............................................lggclnvg.................
00490031   1/1  rylaglglldlleelaeelgidldflrdgllvlaldg.................................
00529261   1/1  drlGGtsrtnggliprgleelldelgipgalldagfpydgllfvfgg.......................
00374411   1/1  taripglgasldlggilfpgl.sprllellaelgleaelarllglrvlilldgtvvsldgdldfevllad
00376431   1/1  ......................................................................
00491501   1/1  GGrsrtaglippgflldlgahvfpg.laplllelleelglelelltlagaavlalldgklidlpadvarl
00468341   1/1  .......................................................ggrsrggglypggle
00406881   1/1  giellllpypgvdlslv.....................................................
00440981   1/1  ......................................................................
00501481   1/1  ......................................................................
00476821   1/1  ggflvdtgadwlfgtep.....................................................
00471331   1/1  ......................................................................
00487711   1/1  lrelveelgid.frrygklvlatgeaelellr......................................
00477121   1/1  ......................................................................
00472701   1/1  ......................................................................
00492221   1/1  ......................................................................
00458811   1/1  lellaelglplglelldlleelleelgidfllgkgvgglsaingvvlergsaedydalipatgaedflgg
00533211   1/1  ......................................................................
00483561   1/1  ......................................................................
00406601   1/1  llrllrelgledlellplglagvirgggsvvnalpdeaeallaelgvl..fpigyaellpfyerleklyg
00467601   1/1  ipskllllaallpellelleglgvefdleekgvdldglrlaydklv........................
00465791   1/1  ......................................................................
00457971   1/1  ......................................................................
00481991   1/1  iekgprlggtclnvgcipskallkaaelaeliellpglgvelllgglgldlaellerkdavv........
00503631   1/1  ......................................................................
00458702   2/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00460571   1/1  alalealdllrelglelgidf..rvgalvlatglaela..............dalllalgap.prlldap
00470291   1/1  nggyigskpdlgaalfg.elldelyelgle........................................
00396641   1/2  ----------------------------------------------------------------------
00483641   1/1  ......................................................................
00461281   1/1  ltllpglfdtll...............agldgrdllarrgkvlggsslingmvylrglpedldelakllg
00359892   2/2  ----------------------------------------------------------------------
00400491   1/2  ----------------------------------------------------------------------
00400351   1/2  ----------------------------------------------------------------------
00359891   1/2  ----------------------------------------------------------------------
00464461   1/2  ----------------------------------------------------------------------
00364591   1/1  aGlkvtllekgdrlggrlllvg................................................
00485831   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00400352   2/2  ----------------------------------------------------------------------
00457951   1/1  eetlellrelgaelglldglvrpngalvl.........................................
00368891   1/1  ......................................................................
00475641   1/1  ----------------------------------------------------------------------
00509271   1/1  ......................................................................
00455181   1/2  ----------------------------------------------------------------------
00444131   1/2  ----------------------------------------------------------------------
00396642   2/2  ----------------------------------------------------------------------
00480451   1/1  ......................................................................
00486071   1/1  ......................................................................
00467501   1/1  ......................................................................
00384491   1/1  ......................................................................
00464161   1/2  ----------------------------------------------------------------------
00488661   1/1  ggtlld................................................................
00458701   1/2  ----------------------------------------------------------------------
00480091   1/1  ......................................................................
00529111   1/1  ----------------------------------------------------------------------
00526001   1/2  ----------------------------------------------------------------------
00499901   1/2  ----------------------------------------------------------------------
00488071   1/1  llEardrlggrlllsgg.....................................................
00455182   2/2  ----------------------------------------------------------------------
00533221   1/1  ......................................................................
00471411   1/1  ----------------------------------------------------------------------
00509611   1/1  d.....................................................................
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00400492   2/2  ----------------------------------------------------------------------
00461561   1/1  eelgveirlntevgkdvtledllleydavv----------------------------------------
00475651   1/1  ......................................................................
00529631   1/1  ----------------------------------------------------------------------
00464462   2/2  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00526002   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00444132   2/2  ----------------------------------------------------------------------
00499902   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
00520321   1/1  ........................rdlleel......gvelllggaglvdprgvellgelgleadallla
00360921   1/1  lepyfelaadalvlatG......srprlpplpgl.elggvlltaaealgldflgkrvvvigg....gasg
00413411   1/1  ......................................................................
00435771   1/1  gs.ypyllelleelglelair..lntevggavllpdgglltvprdladllaellaladgllle.adavil
00470221   1/1  pipgedlggvlhsallldllgkrvvvigggasgldlaellarlgaevtvvlerrdrlllffp........
00363001   1/1  ......................................................................
00523131   1/1  ......................................................................
00462701   1/1  leelleelgieldllvdgrlvvaladealeadalllatGarprllp.......ipgldllgglvvviggg
00484941   1/1  kvlgydlglgalpdspealgleefpgrvvvigggyiglelagkrvrvggakvtllqrrppfvlpllllgl
00406021   1/1  ......................................................................
00465141   1/1  cipgkaldaaalllrllelleelgvelrlppldglllpgvgdvl..........................
00490031   1/1  .......................egleadalllatGapprlld.......ipgldllggrvvvigggvdg
00529261   1/1  ......................................................................
00374411   1/1  geeleadalilatGarprllpipgfdgkgvltardlldllflgkrvvviGg....gvsglelaealarll
00376431   1/1  ......................................................................
00491501   1/1  laarlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlllgll.....llgkrvvvi
00468341   1/1  llrelgledeleelgvdflkalvvlldldlv.......................................
00406881   1/1  ......................................................................
00440981   1/1  ......................................................................
00501481   1/1  ......................................................................
00476821   1/1  ............elglegrgillprgkvlGGsslinggvlvrglpedfdal..................g
00471331   1/1  .....................lelaelleelgvevtllellggdrvlprldldg................
00487711   1/1  ......................................................................
00477121   1/1  ......................................................elleelglldallarg
00472701   1/1  ......................................................................
00492221   1/1  .....rlGGtsrnggvipdgglld..............................................
00458811   1/1  lflpaegilgatgsepfllp.gvsllrvldsagalslafrgkrvvvrltyddnyfndeyqglperekllt
00533211   1/1  ......................................................................
00483561   1/1  .............................................................lvrlalesl
00406601   1/1  vlgegylpdlpgasifkglpvhssfddreldldgkrvvvigsgasavrakavviatGa.reralpapgld
00467601   1/1  ......................................................................
00465791   1/1  ......................................................................
00457971   1/1  ......................................................................
00481991   1/1  ......................................................................
00503631   1/1  ..............................................grypglllllpallyllldlpllf
00458702   2/2  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00460571   1/1  elrellp.....vvvpgggvvd................................................
00470291   1/1  ................................................ldgrrllfprgkvlGGsssing
00396641   1/2  ----------------------------------------------------------------------
00483641   1/1  ......................................................................
00461281   1/1  vegw.gydellpyfkvaedglgltadaiiiatgsrprypgipg....plsvswaldldelpkrlvviggg
00359892   2/2  ----------------------------------------------------------------------
00400491   1/2  ----------------------------------------------------------------------
00400351   1/2  ----------------------------------------------------------------------
00359891   1/2  ----------------------------------------------------------------------
00464461   1/2  ----------------------------------------------------------------------
00364591   1/1  ......................................................................
00485831   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00400352   2/2  ----------------------------------------------------------------------
00457951   1/1  ..........................................aigledadelarlgkrvavlgggel...
00368891   1/1  ......................................................................
00475641   1/1  ----------------------------------------------------------------------
00509271   1/1  ......................................................................
00455181   1/2  ----------------------------------------------------------------------
00444131   1/2  ----------------------------------------------------------------------
00396642   2/2  ----------------------------------------------------------------------
00480451   1/1  ......................................................................
00486071   1/1  ......................................................................
00467501   1/1  ......................................................................
00384491   1/1  ......................................................................
00464161   1/2  ----------------------------------------------------------------------
00488661   1/1  ......................................................................
00458701   1/2  ----------------------------------------------------------------------
00480091   1/1  ......................................................................
00529111   1/1  ----------------------------------------------------------------------
00526001   1/2  ----------------------------------------------------------------------
00499901   1/2  ----------------------------------------------------------------------
00488071   1/1  ......................................................................
00455182   2/2  ----------------------------------------------------------------------
00533221   1/1  ......................................................................
00471411   1/1  ----------------------------------------------------------------------
00509611   1/1  ......................................................................
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00400492   2/2  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00475651   1/1  ......................................................................
00529631   1/1  ----------------------------------------------------------------------
00464462   2/2  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00526002   2/2  ----------------------------------------------------------------------
00380742   2/2  --------------------------------------------------------------lllekgdl
00444132   2/2  ----------------------------------------------------------------------
00499902   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IATNCDMIIMPACFGLANDTLWRWLNERLPCALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
00520321   1/1  tG..rpfdlpipglelfgvrglltlldalkleplllssdlaggllypgkrvvvigggaillealaeaaee
00360921   1/1  velasalarlgagvtvv.....................................................
00413411   1/1  .................................................................lvgrg
00435771   1/1  AtGarprlppipgldlkgvltsrdlldllgkrvvviGgGasgldiaealarlgaevtvverrprllalld
00470221   1/1  ......................................................................
00363001   1/1  ...........................prlggcllllsvpggrldpeelvlalaelleelgvevrlgtev
00523131   1/1  ........................................ggvdrarlaaalaeaaealgveirlgtevt
00462701   1/1  viglela...............................................................
00484941   1/1  llllllll..............................................................
00406021   1/1  ......................................................eaaeelgveiltgtev
00465141   1/1  .............................................gaelaaalaealeelgveillgtrv
00490031   1/1  lela...............................................................ral
00529261   1/1  ..................................................................gfig
00374411   1/1  kilgaevtllers.........................................................
00376431   1/1  ........................................lrvlgaelaaalaealeelgvevllgtevt
00491501   1/1  G.ggaiglelalalarlgaevtlversp..........................................
00468341   1/1  .......................................lalrllgpdvtggerrpragvvdraellral
00406881   1/1  ........................................plllrvlgaelaaalaealeelgveillgt
00440981   1/1  ........................................sklllpgallgaelveallelleelgveil
00501481   1/1  ..........................................llgilgeellarlreqleklgveillgt
00476821   1/1  lgwsyeellpyfkkaekllgvlgalr....kllvvigggaiglglalvldrlgak.vtgvgrldrglptg
00471331   1/1  ...........................................................pellkalleal
00487711   1/1  ..........................elaealralgvd.velldaaelraleplldlpdllgglyvpdgg
00477121   1/1  vpld..............glvvvdgggrlaldfaelalgapgyvvdraellralleaaeelgveirlgtr
00472701   1/1  .......................................................lrvlgpelaeylrel
00492221   1/1  ..................................................pelldll.eelGlpfdlllp
00458811   1/1  lviiGgGn..............................................................
00533211   1/1  ..............................lelaellarl.gaevlrlllglltllergdrllp..ellr
00483561   1/1  dalreliatgarplglpipgrdlgglllardaldldalpkrlavlgggllgvdelaellpllgsevtggl
00406601   1/1  llgrspagalpllsrrflvdllpklllaggglvnlllasdstrylefkalpkslviigggvigvpatrae
00467601   1/1  ..............................................daelaaalaelleklgvevllgt.
00465791   1/1  ................pglgyddrllalakeslellkelgaelgidlfrppgklvvaggg.diglllela
00457971   1/1  ........................................lrvgfiplkrlaelleallelaeklgveil
00481991   1/1  ......................................................................
00503631   1/1  ......................................glpppggggvdraelldylleaaerlgvedvi
00458702   2/2  ----------------------------------------------alvealakalendylealarlgve
00462741   1/1  ----------------------------------------------------------------------
00460571   1/1  .........................................................paallealaeaae
00470291   1/1  gvylrgskndfdl..waglaglegws..ydellpyfkkaekliiatgsrpllpdlpgglllggdgiltse
00396641   1/2  ----------------------------------------------------------------------
00483641   1/1  .........................................llglldeelalrllelleklgvelllgte
00461281   1/1  aiglelapflarlgakvtgvgrlpgllplggvdpsalvaa..............................
00359892   2/2  --------------------------------------------glelaralleaaeelpgveillgtev
00400491   1/2  ----------------------------------------------------------------------
00400351   1/2  ----------------------------------------------------------------------
00359891   1/2  ----------------------------------------------------------------------
00464461   1/2  ----------------------------------------------------------------------
00364591   1/1  ......................................................................
00485831   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00400352   2/2  -ysgvelaealarlgapvtlldrsplarlppgllspgdglldggdgalvaalaealerlgveillgtrvt
00457951   1/1  ..........................................lladgvtgglrpdggrvdparlvralle
00368891   1/1  .................................................................pelaa
00475641   1/1  ----------------------------------------------------------------------
00509271   1/1  ......................................llggvpsglllgaalllallelleklgveill
00455181   1/2  ----------------------------------------------------------------------
00444131   1/2  ----------------------------------------------------------------------
00396642   2/2  ---------------------------------------------------laeaalklgveilegtevt
00480451   1/1  ................................................................pelaaa
00486071   1/1  .lnvgcipskallyagllpdelelleelglpllpgldipvlpgrkgggreellrylaealeklgveirlg
00467501   1/1  .....................................lpgvlggkllaelllrllelllklgvevllg.e
00384491   1/1  ..............................................................dcilskal
00464161   1/2  ----------------------------------------------------------------------
00488661   1/1  ......................................................................
00458701   1/2  ----------------------------------------------------------------------
00480091   1/1  .................................................................eelsl
00529111   1/1  ----------------------------------------------------------------------
00526001   1/2  ----------------------------------------------------------------------
00499901   1/2  ----------------------------------------------------------------------
00488071   1/1  ......................................................................
00455182   2/2  ------------------------------------------vdgaelaaalaeaaeelgveillgtrvt
00533221   1/1  .................................................................eelsl
00471411   1/1  ----------------------------------------------------------------------
00509611   1/1  ......................................................................
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00400492   2/2  ------------------------------------------viglelaaalaealealpgveillgtev
00461561   1/1  ----------------------------------------------------------------------
00475651   1/1  ..................................................................pels
00529631   1/1  ----------------------------------------------------------------------
00464462   2/2  --------------------------------------------glelaralaeaaeelgveillgtrvt
00464162   2/2  ----------------------------------------------elaaalaealeelgveillgtevt
00526002   2/2  ----------------------------------------------slaralleaaealgveiltgtrvt
00380742   2/2  gggclnvgcipgkrllaaaelydelrelleelgipfdevllglllllgrggadgaelaaalaelleelgv
00444132   2/2  ----------------------------------------------alaqalaraaeeagvtvllntevt
00499902   2/2  ----------------------------------------------gglgallealleelgveillgtpv


                         -         *         -         -         -         -         +:350
query           KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
00520321   1/1  lGveiltgtevteierdggrvtgVtvrdtadGeeetiradlvvlatGarsnvrl.lglsglglpgdgyal
00360921   1/1  ..........................yrpdggrgalaralaraaeaagvtvltgtrvteierdggggrvt
00413411   1/1  dgaalaralaeaaealgveiltgtevteilrdeggrvtgVvtadtkdGeevtiradavvlatGafsnlrl
00435771   1/1  alalllgllsldalaalepllalellggllypdggpaalvealaeal.e.gveillgtrvteierdgggv
00470221   1/1  .....................................................pdgqvdpaglvralaea
00363001   1/1  tsidrdgdg...vtledge..tleadavvlAtGarprvlll.......................pglell
00523131   1/1  dllleggrvtgVrtadGe..tlradavvlAtGaf..sr.lllllglelpvgptlgyalvtd---------
00462701   1/1  ralaeaaeelgveillgtrvteilvdeggrvtgvtlrdadGeevtiradavvlatGglsnlrlllglglP
00484941   1/1  ..........................glspdhligagplrggcdyrgggvfgcpggaglvlggrgslaea
00406021   1/1  tei...dg.vvgvvledGeeltieadlvvlatGarsnlrlllgldlpkelleglgleldtrg........
00465141   1/1  tei...dggvvgvttedg..etieadavvlAtGars..............................llll
00490031   1/1  aeaaeelgveillgtrvtellvdeggrvtgvvledadGeevtiradavvlatGgfpn.lrrllgldlpll
00529261   1/1  ledargllrlgagvtvvdrgdllralaeaaeelGveirlgteVtsierdedgrvtgVttedmeplkdGee
00374411   1/1  ..........drllalldd.egqvdprglldalaealeellgveirlgtrvteierdgggvt.vtledgd
00376431   1/1  sidrdgggvtgvllvttgdgetiradavvlAtGar...........................pntplleg
00491501   1/1  ....................................rlgpvlpaglsealaealeallGveirlgtrvte
00468341   1/1  leaaeelGngrveirlgtrvtsierdgelledleeypvtvtlenlseeeakpeelggkvagvllrklled
00406881   1/1  av..ve.dggrvtl....dge..tieadlvvlAtGarsllll....................grrpntel
00440981   1/1  lgtevtsidldgggv...vltdge..tieadavvlAtGar...prllglpgldlpggl............
00501481   1/1  rvtsidldggtv.....vltdgetieadavilAtG.............................vlvaig
00476821   1/1  grgslakallraaerlGveiltnteVtrilrdedgggrvtGVetedadGeert-----------------
00471331   1/1  eklgv.illgt..veilgddggv.gvtledGeeetieadlvvlAtGglsrvrlll...............
00487711   1/1  vvdpaalaaalaraaealGveirlgtevtgierdggrvtgVrtadG..e.ieadlvvlAaG.awsn.ell
00477121   1/1  vtsileedgdgvtvtledggeeetieadlvvgAdGar...srvrrllgip....................
00472701   1/1  leklgveillgtrvtsidrdgdtgrvtgvtledg..etleadavvlAtGars..................
00492221   1/1  gggvvdpaellralaealaeelgveirlgtevtdilrdggrvtgvttedllvdkngvevtdgdggtirad
00458811   1/1  ..............................................dpgklaralaealekrlGveirlg
00533211   1/1  allealeelgveirlgt.vtei...dggvvgvtledGeeetleadlvvlatGsvvrlllg..........
00483561   1/1  rsprggtvdparlvralaeaaeelGveillgtevtsierdgg.vvgVttedGe...iradlvvlAtG.aw
00406601   1/1  ifsskllslaekrrlmkflgrlleyeelpelvldldlrelaellrrlgldvtliellerllagldagpls
00467601   1/1  vteiegddgrvtgvvvvrledge..tleadlvilatGglsllll................lgrrpntell
00465791   1/1  ealrrlgvpvellspeelkellplldfpeflgglytprggtvdpaelvralleaaeelGveillgtevts
00457971   1/1  lgtevtdidlddd..vvvvltdgetitltadavvlAtG...srprllpipgldl..egvltsptsildal
00481991   1/1  ..............................dgeelaaalaelleelgvevllgtav.ii..ddgtvtv..
00503631   1/1  rlgtevtsidfdedgvvvgvttedG..etiead-------------------------------------
00458702   2/2  irlgtrvteilrdgggvt.vttadGe..tieadavvlatgarplaell.gllgpelpergiiavdglpvg
00462741   1/1  ----------------------------------------------------------------------
00460571   1/1  elGveirlg.rvtsi...............dGetleadlvvlatGags.rellg.....dlglepvrggf
00470291   1/1  lalsl....dllpklvvvigggaiglelapvlarlgakvtgvgrlprglpvgdgglsalvaalakalerl
00396641   1/2  ----------------------------------------------------------------------
00483641   1/1  vtsidlegktvtllllvlgdgetleydklvlAtGarp..........................vvvaigv
00461281   1/1  ......................................................................
00359892   2/2  teilgdgdgvtvttgrvtgvvlrdladGeevtiradlvvlatGarsnllllllsgigptgdglallerag
00400491   1/2  ----------------------------------------------------------------------
00400351   1/2  ----------------------------------------------------------------------
00359891   1/2  ----------------------------------------------------------------------
00464461   1/2  ----------------------------------------------------------------------
00364591   1/1  ..............gipggvlpeelvealaelleklgveirlgtrvt.....dg..vgvttedg..etie
00485831   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00400352   2/2  eilrdgggvtgVttedgeleldgeevtiradavvlatGarssprllllsgigpaellkalgielpl....
00457951   1/1  aleelGveillg.evteierdg...dGe...........adlvvlAtGa.rsplllkl......pllpvr
00368891   1/1  allelleklgvevllgtevtaidvdgdgvt----------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00509271   1/1  gtevtsidldggtvvgvttgdgetltad....vlAtGarprllllll....vpgipgfdgkgvhtartll
00455181   1/2  ----------------------------------------------------------------------
00444131   1/2  ----------------------------------------------------------------------
00396642   2/2  ellgdgdgkgrvtgvvtkdlktgevgtiradavvlatGgagnlllllsvlepdlrttnpptntgdglala
00480451   1/1  llelleklgvelllgtrvtaidldgggvt.vt--------------------------------------
00486071   1/1  talfvdpnrVts........vtvttedGetgelvpgetiradavvlA-----------------------
00467501   1/1  vtsidpdgktvt...ledg..etleydllvlAtGa...rprllpipgldl..egvltlrtlldalalrea
00384491   1/1  lelleelgvevllgtevteveldgggvvvvlg--------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00488661   1/1  ........eelaaallelleklgvevllgtrv--------------------------------------
00458701   1/2  ----------------------------------------------------------------------
00480091   1/1  lllelleklgvelllgtrvtaidvdgdgvtvt--------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00526001   1/2  ----------------------------------------------------------------------
00499901   1/2  ----------------------------------------------------------------------
00488071   1/1  .........ipgkvdpaellealaelaeelgvei------------------------------------
00455182   2/2  .i...dggvvgvtt.dge..tiradavilAtGalslplll............................gl
00533221   1/1  allelleklgvelllgtrvtaidvdgdgvtvt--------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00509611   1/1  .....pelskallelleklgvelllgtevteid-------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00400492   2/2  tellgdggrvtgvvledgetgeevtira..davvlatGgrpnlellltnppgntgdglalleraglel..
00461561   1/1  ----------------------------------------------------------------------
00475651   1/1  kallelleklgvelllgtevtaidgdgdgv----------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00464462   2/2  eilvdeggrvtgvttedadGeeltiradavvlatGgfpnlalllglglpphPdgrllfgprdddellrll
00464162   2/2  .i..edgrv.gvtledgeeltleadlvilatGrrslPlllpntellgleklgvelder............
00526002   2/2  eilrdedggrvtgVetrdladGeeftiradlVvlaaGaipspr.llllsGiglpevgrilvdh.....pg
00380742   2/2  evllgtavt.i..ddgrVtl....dge..titadavilAtGar.prll......................
00444132   2/2  eilvdgdgrvvgVetedGe..tirAdlVvlaaGa------------------------------------
00499902   2/2  tei................Ge.leadavvlatgldplaellgle....lpergl................


                         -         -         -         -         *         -         -:420
query           DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ-
00520321   1/1  airvgeplpdhl.........pggivvdetlrts.....vpglyaaGdaaggsghganplg.gngl----
00360921   1/1  gVtledgegltgeevtiradlvvlaaGarsttrllllsglglp.............lppdlgvvgr----
00413411   1/1  llglglgltgdglalalrlgaplpdggflqfhPthytmggivvdpdlr.....tsvpglyaaGdaa----
00435771   1/1  t.vttedadgslkpvledgetieadavvlatGarslarllldpplppvrgqalptlplg..........-
00470221   1/1  leallgveirlgtrvteierdgggvt.VttadGe..tieadlvvlatGarsllrll.glpglgl------
00363001   1/1  egagleldggivvdeylrt.....svpgvyaaGdvagvplpllglggggglaavAllsgrvaaenllg--
00523131   1/1  ----------------------------------------------------------------------
00462701   1/1  ifPdgrlllgprpddelrellpglgvalde........................hywaggipvdpdg---
00484941   1/1  llealeelpGveirlgteVteiegdgggvt.VttedGee..ieadlVilatGarsslrl.ledsglpp--
00406021   1/1  .........givvdetlrt.....svpglyaaGdaagp......gqgvatalasGrlaaeaiagylkgl-
00465141   1/1  lgrrpntellglegaglelderggivvdetlrt.....svpglyaaGdaagg......gglvatAiasGr
00490031   1/1  pvrgtalalgatgdglallerag..............velddrgfvqffPtll...givvdetlr..---
00529261   1/1  kpvpveG..etiradlvvlAtGarssprlllleglgle.dgrgyi......................---
00374411   1/1  geeetiea..dlvvlatGarsltellglpplp................prlfpaleglglvpgg------
00376431   1/1  lglelderggivvdetlrts.....vpglyaaGdaaggvnp.....lagvAlasGrlaalniagylkgld
00491501   1/1  ierdgggvt.vttedGdgeeetieadavvlatGarpllr.lledlglp...............eplr---
00468341   1/1  gddgrvt.vttedldtgGeeetiradlvvlAtGar..s.llrkllglelpgggv.........-------
00406881   1/1  lllelagleldrggivvdetlrt.....svpgvyaaGdaagg......grgaavAiasGrlaaeaiagy-
00440981   1/1  ...ealglelderggivvdetlrts.....vpglyaaGdvaggpgp.....lavtAlasGrlaalnia--
00501481   1/1  rrpntellkl.glelderggivvdelllrtsvpgvfaaGdvaggplr.....lavvAvaeGriaalai--
00476821   1/1  ----------------------------------------------------------------------
00471331   1/1  .........vrpntellglealgleldierggilvd...etlrts.vpgvfaaGdavhgappl.....av
00487711   1/1  ellglelpp..........................pdglpvigp.vtg.....vpglylagga..-----
00477121   1/1  .......................prtsvgrvflaGDaahavhplg.gqGlnlAiedarllaea-------
00472701   1/1  ...............npnilglegagllderggivvdetlr.....tsvpgvfaaGdvaggp.....lgl
00492221   1/1  avvlAtGar.------------------------------------------------------------
00458811   1/1  tevteierdeggrvt.vttedgetkdvlgeeeeieadlvvlaaGarpstrllllsgigleldpr------
00533211   1/1  ...............vrpnlegllleglglelderggivvdetlrt.svpgvyaaGdaaggp......kl
00483561   1/1  spel.lkllgielplgllpvrgqilvv...----------------------------------------
00406601   1/1  apsaaialrlfl.............gslgrygnggclypvgg----------------------------
00467601   1/1  gleaaglelderggivvdetlrt.....svpgiyaaGDvagg......prlaavAlaeGrvaalniagyl
00465791   1/1  ierdg-----------------------------------------------------------------
00457971   1/1  alllellpgklv.viggGaivllaigrrpntellglegagleldrggivvdetlr.....tsvpgiy---
00481991   1/1  ..dge..tieadlvilAtGar...prlpplpg.....................grrpntelleaaglel-
00503631   1/1  ----------------------------------------------------------------------
00458702   2/2  sllkvhlgfdepf............P......vpglflaGdatgpggp....ggvagaiasGrraaeail
00462741   1/1  ----------------------------------------------------------------------
00460571   1/1  ivvdpp......dpeilrrwvglrpltpdglplrtp.vpglylagd........hggqgvtlalasg---
00470291   1/1  gveiltntrvtrilvdggggglrvtgVetedgggeektiradkeVilaaGaigsprllllsgiglk----
00396641   1/2  ----------------------------------------------------------------------
00483641   1/1  tpntgllk.aglelderggivvdetlrt.svpgiyAaGDvagvpglllgllllpklaavAvaqgrvaa--
00461281   1/1  ..........lakalerlgveiltntrvtrilrdgggkglrvtgvevetadGeevtiradkeVilaaGa-
00359892   2/2  lelvde..........................rggivvdeglrt.....svpglyaaGdaagpglpl---
00400491   1/2  ----------------------------------------------------------------------
00400351   1/2  ----------------------------------------------------------------------
00359891   1/2  ----------------------------------------------------------------------
00464461   1/2  ----------------------------------------------------------------------
00364591   1/1  adavilAtGar.pntllll..................................rggivvdeylrtsv---
00485831   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00400352   2/2  .....dlpgvgenlidhptgglla.rmgtpdggivvdptlrtlgvpglyaaGdaag...p...gggvg--
00457951   1/1  gqilvleplat.----------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00509271   1/1  dldllgkrvvviGggaiglelaligvrpntegllledaglelderggilvdetlrts.vpglyaaGdvag
00455181   1/2  ----------------------------------------------------------------------
00444131   1/2  ----------------------------------------------------------------------
00396642   2/2  lraglelaglelfvqfhptglitepvrg..........................givvdenge-------
00480451   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00467501   1/1  l---------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00458701   1/2  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00526001   1/2  ----------------------------------------------------------------------
00499901   1/2  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00455182   2/2  spntpgllleglgielderggivvdenlrt.....svpglyaaGdvagg......gngvavaiasGrlaa
00533221   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00400492   2/2  .......................hdtrggivvdetlrt.....svpglyaaGdvagtplhgagrlgg---
00461561   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00464462   2/2  pglgvaliar.......................ytaggipvdpdgrpllgrltsvpglyaaGdaa-----
00464162   2/2  ..............ggilvdetlrt.....svpglyaaGdvagg......grlavvaiaeGrlaalaia-
00526002   2/2  ggvlilphwsgtrpmgpdpvvdedlrthgvpglfvaGdaaf.ptgg.ggngvltaiasgrraadailgal
00380742   2/2  ...glpgitptllleaagvelderggivvdetlrts.vpglyaaGdvagg......grlavvAvaeGrla
00444132   2/2  ----------------------------------------------------------------------
00499902   2/2  ..........ivvdpglr.....tgvpglylaGdaagpggp.....gvtgaiasgrlaadailgllk---