[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69636.1


[Show Plain Result]

## Summary of Sequence Search
   1::289
   1::266    6e-81 39.8% 0045776 00457761 1/1   )-linked oxidoreductase                 
   1::266  6.7e-81 41.7% 0046225 00462251 1/1   )-linked oxidoreductase                 
   1::266  3.9e-79 39.0% 0046848 00468481 1/1   )-linked oxidoreductase                 
   2::266  4.7e-79 38.6% 0049299 00492991 1/1   )-linked oxidoreductase                 
   1::266  8.8e-79 38.6% 0046098 00460981 1/1   )-linked oxidoreductase                 
   1::266  9.2e-78 37.1% 0049058 00490581 1/1   )-linked oxidoreductase                 
   1::266  2.2e-77 40.5% 0047570 00475701 1/1   )-linked oxidoreductase                 
   1::266  2.2e-77 39.4% 0050262 00502621 1/1   )-linked oxidoreductase                 
   1::277  1.6e-76 38.8% 0048892 00488921 1/1   )-linked oxidoreductase                 
   1::266  4.2e-76 42.0% 0049985 00499851 1/1   )-linked oxidoreductase                 
   1::266  1.2e-75 42.0% 0051795 00517951 1/1   )-linked oxidoreductase                 
   3::266  2.4e-75 39.9% 0045771 00457711 1/1   )-linked oxidoreductase                 
   1::266  1.2e-73 40.0% 0047367 00473671 1/1   )-linked oxidoreductase                 
   3::277    1e-70 37.1% 0048247 00482471 1/1   )-linked oxidoreductase                 
   1::271  6.3e-69 36.5% 0048014 00480141 1/1   )-linked oxidoreductase                 
   1::264  1.3e-68 38.8% 0047249 00472491 1/1   )-linked oxidoreductase                 
   1::268  1.5e-67 36.9% 0048846 00488461 1/1   )-linked oxidoreductase                 
  11::275  6.9e-67 33.7% 0047069 00470691 1/1   )-linked oxidoreductase                 
   1::266  3.3e-66 34.5% 0048842 00488421 1/1   )-linked oxidoreductase                 
   5::269  8.6e-66 34.5% 0048562 00485621 1/1   )-linked oxidoreductase                 
   1::266  3.4e-65 35.9% 0046647 00466471 1/1   )-linked oxidoreductase                 
   1::289


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTR
00457761   1/1  eyrvlgntglkvpalglGtmrlgg.eealaavraaldaGinhiDtAdvYgsEelvGealkellkesgvkR
00462251   1/1  meyrvlgntglkvpalglGtmrlgg.eeaiaavraaldaGinhiDtAdvYgsEelvGealkelleeglgv
00468481   1/1  eyrvlgntglkvpalglGtmrlgd.eeavaavkaaldaGinhiDtAdvYgsEelvGealkellkesgvkR
00492991   1/1  -yrrlgntglkvpalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYgsEelvGealkellkesgv
00460981   1/1  eyrvlgntglkvpalglGtmrlgg.eealaavraaldaGinhiDtAdvYgsEelvGealkellkesgvkR
00490581   1/1  eyrrlgntglkvsalglGtmrlgd.eeaiaalraaldaGinfiDtAdvYgsEelvGealkellkesgvpr
00475701   1/1  meyrvlgntglkvsalglGtmrlgg.eeaiaavraaldaGinfiDtAdvYgsEelvGealkellkesgvk
00502621   1/1  meyrvlgntglkvsalglGtmrlgg.eealaavraaldaGinliDtAdvYgsEelvGealkellkesgvp
00488921   1/1  llmeyrvlgntglkvpalglGtmrlggldeeeavaavraaldaGinhiDtAdvYgsEelvGealkellke
00499851   1/1  meyrvlgntglkvpalglGtmrlgd.eealaavraaldaGinhiDtAdvYgsEelvGealkellkesgvk
00517951   1/1  meyrvlgntglkvpalglGtmrlgg.eeaiaavraaldaGinhiDtAdvYgsEelvGealkellkeglgv
00457711   1/1  --lllmeyrvlgntglkvpalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYgsEelvGealkel
00473671   1/1  lmeyrvlgntglkvsalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYgsEelvGealkellkes
00482471   1/1  --lmeyrvlgntglkvsalglGtmrlgg.eealallraaldaGinliDtAdvYgsEellGealkel....
00480141   1/1  meyrrlgntglkvsalglGtmtlggqldeeeaiaaldaaldaGinfiDtAdvYgvplsaellglsEellG
00472491   1/1  meyrllgntglkvsalglGtmrlgg.eealallraaldaGinliDtAdvYgsEellGealkel....gvp
00488461   1/1  meyrklgntglkvsalglGtmtlgglyggqvdeeealalldaaldaGinfiDtAdvYgnglsEellGeal
00470691   1/1  ----------kvsalglGtmtlggaldeeeaialldaaldaGinfiDtAdvYgdglsEellGealkel..
00488421   1/1  eyrrlgnsglkvsalglGtmtlgglyllgaldeeealalldaaldaGinfiDtAdvYgdglsEellGeal
00485621   1/1  ----lmeyrllgntglkvsalglGtmtlgglyldeeeaialldaaldlGinfiDtAdvYgn.glsEellg
00466471   1/1  lmeyrrlgnsglkvsalglGtmtlgggqldeeealalldaaldaGinfiDtAdvYgdglsEellGealke


                         -         -         *         -         -         -         -:140
query           EELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVS
00457761   1/1  edlfiaTKlgp.tdlsrehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllslvple
00462251   1/1  pRedlfiatKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllllvp
00468481   1/1  edlfiaTKlgp.tdlsrehvraaleeslkrLgtdyiDlyliHwpdplklldlllpldedgllllllvple
00492991   1/1  kRedlfiaTKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllllvp
00460981   1/1  edlfiaTKlgp.tdlsrehvraaleeslkrLgtdyiDlyliHwpdplklldlllpldedgllllllvple
00490581   1/1  edlfiaTKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpvalkllelldplvpleetlealeelv
00475701   1/1  RedlfiatKlgl.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllallllllldedglll
00502621   1/1  redlfiaTKlgl.tdlspehvraaleeslkrLgtdyiDlyllHwpdppleetlealeelvkeGkvraiGv
00488921   1/1  sgvkRedlfiaTKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllll
00499851   1/1  RedlfiaTKlgl.tdlsrehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllllvpl
00517951   1/1  pRedlfiatKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllslvp
00457711   1/1  lkesgvkRedlfiaTKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgll
00473671   1/1  gvkRedlfiaTKlgp.tdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllll
00482471   1/1  gvpredlfiaTKlg...dlspehvraaleeslkrLgtdyiDlyllHwpdpllvpleetlealeelvkeGk
00480141   1/1  ealkelg.....pRddlviaTKvgitlgdgpnllvllldlsrehiraaleaslkrLgtdyiDlyllHwpd
00472491   1/1  redlfiaTKlgl.tdlspehvraaleeslkrLgtdyiDlyllhwpdpllvpleetlealeelvkeGkvra
00488461   1/1  kelg.....krddlviaTKvgptlgdgvnlldl.spehiraaleeslkrLgtdyiDlyllHrpdpltple
00470691   1/1  ..gvprddlviaTKvglrnglglsrehiraaleasLkrLgtdyiDlyllHrpdpltpleetlealeelvk
00488421   1/1  k.....g.vprddlviatKvglllldgpnlldlsrehiraaleeslkrLgtdyiDlyllHrpdpltplee
00485621   1/1  ealkdlgvkRddlfiaTKvgillgdgpnllvllldlspehiraaleesLkrLgtdyiDlyllHrpdpltp
00466471   1/1  l....gvprddlviaTKvgilllglnlldlsrehiraaleaslkrLgtdyiDlyllHrpdpltpleetle


                         +         -         -         -         -         *         -:210
query           NFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADA
00457761   1/1  etlealeelvkeGkvraiGvSnfsaeqleellelaeglvppavnqveynlllrelellelckelgigvla
00462251   1/1  leetlealeelvkeGkvraiGvSnfsaeqleellavakippavnqveynlllrelellelcrelgigvla
00468481   1/1  etlealeelvkeGkvraiGvSnfsaeqleellalaeglippvvnqveynlllrelellelckelgigvla
00492991   1/1  leetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrelellelcrelgigv
00460981   1/1  etlealeelvkeGkvraiGvSnfsaeqleellalaeglippvvnqveynlllrelellelckelgigvla
00490581   1/1  keGkvraiGvSnfsaeqleellalaevppavnqveynlllrerellelcrelgigvlaysPlggGlltgk
00475701   1/1  lslvpleetlealeelvkeGkvraiGvSnfsaeqleellalakippavnqveynlllrelellelckelg
00502621   1/1  SnfsaeqleellelaeippavnqveynlllrelellelcrelgigvlaysPlggglltgkydevlkeiae
00488921   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrerellelcrelg
00499851   1/1  eetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrelellelckelgigvl
00517951   1/1  leetlealeelvkeGkvraiGvSnfsaeqleellavakippavnqveynlllrelellelcrelgigvla
00457711   1/1  llsltpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrelellelck
00473671   1/1  vpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippvvnqveynlllrelellelcrelgi
00482471   1/1  vraiGvSnfsaeqleellelapivpvqnqynllprlaerellelcrelgigvlaysPlggglllgkydev
00480141   1/1  alklldgllllllllllpltpleetlealeelvkeGkvryiGvSnfsaeqleealevaellglippvvnq
00472491   1/1  iGvSnfsaeqleellelapivpvqnqynllprlaerellelcrelgigvlaysPlggglllgkydevlke
00488461   1/1  etlealeelvkeGkiryiGvSnfsaeqleealelak..pvvvQveynlllrqaerellplcrelgigvla
00470691   1/1  eGkvryiGvSnfsaeqleealavaeklglvppvvnqveynlllrqaerellplcrelgigvvaysPlagG
00488421   1/1  tlealeelvkeGkvryiGvSnfsaeqleealav..vppvvvqveynlllrqaerellplcrelgigvvay
00485621   1/1  leetlealeelvkeGkvryiGvSnfsaeqleealalagvppvvnqqelyplllreaelellplcrelgig
00466471   1/1  aleelvkeGkvryiGvSnfsaeqleealavaellglvppvvvqveynlllrqalelellplcrelgigvv


                         -         -         -         +         -         -         -:280
query           HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVR
00457761   1/1  ysPlggglltgkyldgallledevlkeiakkhgvtpaqvalawllqrgvvvipgss--------------
00462251   1/1  ysPlggglltgkyldgallledevlkeiakkhgvtpaqvalawllqrgvvvipgas--------------
00468481   1/1  ysPlggglltgkyldgpllllvpvlkeiakkhgvtpaqvalawllqrgvvvipgas--------------
00492991   1/1  laysPlggglltgkylpgapllllvevlkeiakkhgvtpaqvalawllqrpvvvip--------------
00460981   1/1  ysPlggglltgkyldgalllllpvlkeiaekhgvtpaqvalawllqrgvvvipgas--------------
00490581   1/1  ylsgllfllelleallllvevlkeiakkhgvtpaqvalawllqrpvvvipgasspe--------------
00475701   1/1  igvlaysPlggglltgkylggalpeallllvevlkeiakkhgvtpaqvalawllqr--------------
00502621   1/1  klgvspaqvalawllqrgvvvipgassperleenlaaldfelseeelaaldellkn--------------
00488921   1/1  igvlaysPlggglltgkylpgapllllvevlkeiakkhgvspaqvalawllqrpvvvipgasnperl---
00499851   1/1  aysPlggglltgkyldgaalllvpvlkeiakkhgvtpaqvalawllqrgvvvipgs--------------
00517951   1/1  ysPlggglltgkyldgallledevlkeiaekhgvtpaqvalawllqrgvvvipgas--------------
00457711   1/1  elgigvlaysPlggglltgkylsgapllllvevlkeiakkhgvtpaqvalawllqr--------------
00473671   1/1  gvlaysPlggglltgkylpgapllllvevlkeiakkhgvspaqvalawllqrpvvv--------------
00482471   1/1  lkeiaeklgvspaqvalawllqrgvvvipgassperleenlaaldfelseeelaaldellrglrvvg---
00480141   1/1  veynlllrqaerellplcrelgigvlaysPlagGlLtgkylsgalpdgdlrrllprflrel---------
00472491   1/1  iaeklgvspaqvalawllqrpavvipgassperleenlaaldlelsdeelaald----------------
00488461   1/1  ysPlagGlLtgkyldgalpdsgdlrsllplfldelleellelvealeeiaklkhgvsp------------
00470691   1/1  lLtgkylsgallasgdlrlllasllllllllprflrelleallllvealaeiaeklgvspaqval-----
00488421   1/1  sPlagGlltgkylsgallasgdlrlllprflrelleallllvealkeiaekhgvtp--------------
00485621   1/1  vlaysPlagglltgkylsgllllevlkeiakkhgvtpaqvalawllqrpavtvvipgas-----------
00466471   1/1  aysPlagGlLtgkyldglllasgrllldlrlllprflgelleallllvealaeiak--------------


                         -         *         -         -         -         -         +:350
query           GCLGVKIHD-------------------------------------------------------------
00457761   1/1  ----------------------------------------------------------------------
00462251   1/1  ----------------------------------------------------------------------
00468481   1/1  ----------------------------------------------------------------------
00492991   1/1  ----------------------------------------------------------------------
00460981   1/1  ----------------------------------------------------------------------
00490581   1/1  ----------------------------------------------------------------------
00475701   1/1  ----------------------------------------------------------------------
00502621   1/1  ----------------------------------------------------------------------
00488921   1/1  ----------------------------------------------------------------------
00499851   1/1  ----------------------------------------------------------------------
00517951   1/1  ----------------------------------------------------------------------
00457711   1/1  ----------------------------------------------------------------------
00473671   1/1  ----------------------------------------------------------------------
00482471   1/1  ----------------------------------------------------------------------
00480141   1/1  ----------------------------------------------------------------------
00472491   1/1  ----------------------------------------------------------------------
00488461   1/1  ----------------------------------------------------------------------
00470691   1/1  ----------------------------------------------------------------------
00488421   1/1  ----------------------------------------------------------------------
00485621   1/1  ----------------------------------------------------------------------
00466471   1/1  ----------------------------------------------------------------------