[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69765.1


[Show Plain Result]

## Summary of Sequence Search
   1::115
   1::60   9.7e-10 40.0% 0037930 00379301 1/1   ive DNA-binding domain                  
   1::67   1.1e-09 37.3% 0044064 00440641 1/1   ive DNA-binding domain                  
   1::115


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVDHHADTFTPAS
00379301   1/1  ytakellglpglPgskqginrrakkegwlsrkreGvkGgkaveyhisslPeevrealllk----------
00440641   1/1  ytakelaglpglPgsrqgvnkrakkegwlsrkreGvkGgkaveyhisslPeevraalllrleellle---


                         -         -         *         -         -         -         -:140
query           NASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDSK-------------------------
00379301   1/1  ----------------------------------------------------------------------
00440641   1/1  ----------------------------------------------------------------------