[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69930.1


[Show Plain Result]

## Summary of Sequence Search
   1::152
   1::131  2.2e-43 44.2% 0051712 00517121 1/1   posase IS200-like                       
   4::129  1.7e-38 37.3% 0052809 00528091 1/1   posase IS200-like                       
   3::135  1.5e-37 38.0% 0052598 00525981 1/1   posase IS200-like                       
   1::152


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPP
00517121   1/1  lmdyrslrhsvyllkyhiVfvtkyRrkvltgeirerlkeilreiaeelgveilelnvmpDHvHllvslpp
00528091   1/1  ---lrllrhsvpgllyhivfvtkyRrkvllddirdrlleilreiaeeygveilayvvmpDHvHllvslpp
00525981   1/1  --mlrklrhsvpgllyhivfvtkyRrkvlldeirerlleilrelaeeygveilafvvmpDHvHllvslpp


                         -         -         *         -         -         -         -:140
query           KMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLS
00517121   1/1  klsvsklvgalKgvssrllrkefpelk..lwggtlWqrgYfvatvggvslevvkkYIenQp---------
00528091   1/1  klslsklvqalkgrssrlinkefpelkkllrgghlWqrgyfvhtvgdedleavlrYIen-----------
00525981   1/1  klslsklvgllkgrssrlinkefpel....rgghlWqrgyfvhtvgnesleavlrYIennpvkag-----


                         +         -         -         -         -         *         -:210
query           IPYPGSPFTGRK----------------------------------------------------------
00517121   1/1  ----------------------------------------------------------------------
00528091   1/1  ----------------------------------------------------------------------
00525981   1/1  ----------------------------------------------------------------------