[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF70405.1


[Show Plain Result]

## Summary of Sequence Search
   1::478
 193::477  9.6e-91 44.1% 0047515 00475151 1/1   like cupins                             
 149::478  2.8e-58 38.2% 0051192 00511921 1/1   like cupins                             
   6::345  2.3e-57 28.4% 0038427 00384271 1/1   otide-diphospho-sugar transferases      
   1::304    9e-56 32.3% 0051364 00513641 1/1   otide-diphospho-sugar transferases      
   6::339  4.2e-53 27.0% 0040693 00406931 1/1   otide-diphospho-sugar transferases      
   1::308  1.1e-51 29.7% 0047373 00473731 1/1   otide-diphospho-sugar transferases      
   5::334    4e-50 26.3% 0046877 00468771 1/1   otide-diphospho-sugar transferases      
   6::360  6.8e-47 28.8% 0048137 00481371 1/1   otide-diphospho-sugar transferases      
   2::295  3.2e-39 32.0% 0050387 00503871 1/1   otide-diphospho-sugar transferases      
   5::299  4.4e-38 29.1% 0050195 00501951 1/1   otide-diphospho-sugar transferases      
 337::477  4.3e-36 40.1% 0043585 00435851 1/1   like cupins                             
   5::307  6.6e-35 26.1% 0038005 00380051 1/1   otide-diphospho-sugar transferases      
   3::297  2.5e-34 32.4% 0050266 00502661 1/1   otide-diphospho-sugar transferases      
   4::302  2.6e-32 27.2% 0044168 00441681 1/1   otide-diphospho-sugar transferases      
   3::293  1.3e-31 30.0% 0047707 00477071 1/1   otide-diphospho-sugar transferases      
 345::478  4.4e-31 34.4% 0048019 00480191 1/1   like cupins                             
 348::460  7.4e-28 31.9% 0048484 00484841 1/1   like cupins                             
 360::467  3.6e-27 34.6% 0051939 00519391 1/1   like cupins                             
 351::472    1e-26 29.2% 0050205 00502051 1/1   like cupins                             
   1::221  3.6e-26 30.1% 0046466 00464661 1/1   otide-diphospho-sugar transferases      
 334::460  6.7e-26 36.0% 0051311 00513111 1/1   like cupins                             
   6::289  2.2e-25 22.0% 0053095 00530951 1/1   otide-diphospho-sugar transferases      
   4::307  1.3e-24 24.6% 0038743 00387431 1/1   otide-diphospho-sugar transferases      
 366::462  5.4e-24 33.0% 0050074 00500741 1/1   like cupins                             
 364::477  3.8e-22 29.8% 0050871 00508711 1/1   like cupins                             
   3::293  4.5e-22 26.6% 0044743 00447431 1/1   otide-diphospho-sugar transferases      
 356::471  1.1e-21 26.7% 0046787 00467871 1/1   like cupins                             
 364::470  8.4e-21 28.6% 0051250 00512501 1/1   like cupins                             
 346::474  1.8e-20 28.1% 0049912 00499121 1/1   like cupins                             
 346::478  1.9e-19 28.5% 0047410 00474101 1/1   like cupins                             
 365::475  6.9e-19 32.4% 0043706 00437061 1/1   like cupins                             
 356::476  7.1e-19 27.4% 0047686 00476861 1/1   like cupins                             
 318::477  1.1e-18 20.1% 0047506 00475061 1/1   like cupins                             
 371::474  2.8e-17 27.9% 0051625 00516251 1/1   like cupins                             
   1::259  2.3e-16 24.8% 0038881 00388811 1/1   otide-diphospho-sugar transferases      
 343::472  1.4e-14 24.8% 0043192 00431921 1/1   like cupins                             
   1::294  4.4e-14 26.5% 0046659 00466591 1/1   otide-diphospho-sugar transferases      
 371::459  3.2e-13 29.2% 0052017 00520171 1/1   like cupins                             
 384::460  4.5e-13 28.6% 0049374 00493741 1/1   like cupins                             
 350::470  5.2e-13 22.7% 0052595 00525951 1/1   like cupins                             
   5::295  1.4e-12 22.7% 0050366 00503661 1/1   otide-diphospho-sugar transferases      
 382::471  2.5e-11 26.1% 0051300 00513001 1/1   like cupins                             
   5::257  4.4e-11 25.7% 0050178 00501781 1/1   otide-diphospho-sugar transferases      
 367::457  5.8e-11 23.9% 0040530 00405301 1/1   like cupins                             
 385::457  1.9e-10 38.9% 0046334 00463341 1/1   like cupins                             
 359::464  2.2e-10 25.7% 0048543 00485431 1/1   like cupins                             
 369::469    3e-09 29.0% 0046882 00468821 1/1   like cupins                             
 365::461  3.4e-09 26.0% 0050297 00502971 1/1   like cupins                             
   4::265  5.4e-09 24.3% 0038462 00384621 1/1   otide-diphospho-sugar transferases      
 339::478  5.4e-09 19.7% 0051916 00519161 1/1   like cupins                             
   4::278  6.2e-09 23.9% 0049057 00490571 1/1   otide-diphospho-sugar transferases      
 347::457  5.7e-08 19.6% 0043023 00430231 1/1   like cupins                             
 372::461  5.7e-08 32.6% 0041796 00417961 1/1   like cupins                             
 382::459  2.1e-07 29.5% 0046333 00463331 1/1   like cupins                             
 325::442  2.2e-07 23.6% 0045016 00450161 1/1   like cupins                             
 373::455  2.7e-06 25.3% 0039319 00393191 1/1   like cupins                             
 384::452  0.00017 33.3% 0047411 00474111 1/1   like cupins                             
 384::462  0.00018 29.1% 0053269 00532691 1/1   like cupins                             
 369::480  0.00026 23.4% 0037841 00378411 1/1   like cupins                             
   1::478


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
00475151   1/1  ----------------------------------------------------------------------
00511921   1/1  ----------------------------------------------------------------------
00384271   1/1  -----mimkavILAaGlGtRLrpltr.alPKqllpvggk.Pliqytlerlaaagideivvvtgeylaeli
00513641   1/1  lllllllmmkvmkavILAGGlGtRLrPlTka.rPKpllpvggkyplidytlsrlanagieeivvvtgyka
00406931   1/1  -----lkimkAvILAGGlGtRLrPlTra.lpKpllpvagk.Plieytlerlaaagieeivvvtgylalel
00473731   1/1  M..mkmkavIlAgGlGtRlgplTsd.rpKpllpl.ggkpliqhtlerllaagideivvvtgykareliee
00468771   1/1  ----mmkavILAGGlGtRlrPlTsa.lpKpllpv.ggkPlieytlerlaaagideivvvtgykdaeliee
00481371   1/1  -----hmkavIlAgGlGtRlgpltsd.rpKpllpl.ggkpliehtlerllaagideivvvtgykalelia
00503871   1/1  -lkmkmkaviLAgGsGtRlgp....dlpKqllpl.agkpllqhtlerllaaglideivvvtgpedlelie
00501951   1/1  ----kmkavIlAgGlGtRl.p......pKpllpl.ggkpliehtlerllaagideivvvtg...deeiae
00435851   1/1  ----------------------------------------------------------------------
00380051   1/1  ----kmkavILAaGlGtRlgplt....pKpllpi.ggkpllehvleallaagideivvvtgyka.eaiee
00502661   1/1  --mmkmkaiIlAaGkGtRlgp....dlpKqllpl.ggkplleytleallaaglideivvvtgyedeliee
00441681   1/1  ---mkmkavILAgGlGtRlgplTsd.lpKpllpl.ggkPliehvlealaaagideivvvtgykaelieel
00477071   1/1  --mmkmkavIlAaGlGtRlgplTsd.lpKpllpv.ggkplieytleallaagideivvvtgyka.eliee
00480191   1/1  ----------------------------------------------------------------------
00484841   1/1  ----------------------------------------------------------------------
00519391   1/1  ----------------------------------------------------------------------
00502051   1/1  ----------------------------------------------------------------------
00464661   1/1  M..mkikavIlAgGlGtRlgp.....lpKpllpi.ggkpliehvlerll.agideiivvtgyk.....ae
00513111   1/1  ----------------------------------------------------------------------
00530951   1/1  -----dllrelleglllllklseldlesflalferlllellelldidlipllplelvvslldlellldle
00387431   1/1  ---mkmkavILAaGlGtRlgplt....pKpllpia.gkpllehvlerllaagideivvvtgydd.eliee
00500741   1/1  ----------------------------------------------------------------------
00508711   1/1  ----------------------------------------------------------------------
00447431   1/1  --mmkmkavilAAGlGtRlgp....dlPKqllpl.ggkpllehvleallaaglideiivvvgykdeliee
00467871   1/1  ----------------------------------------------------------------------
00512501   1/1  ----------------------------------------------------------------------
00499121   1/1  ----------------------------------------------------------------------
00474101   1/1  ----------------------------------------------------------------------
00437061   1/1  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------
00475061   1/1  ----------------------------------------------------------------------
00516251   1/1  ----------------------------------------------------------------------
00388811   1/1  m..mkmkavilAAGlGtRmgp....dlpKpllpl.ggkpllehvleallaaglideivvvvgygd.eaie
00431921   1/1  ----------------------------------------------------------------------
00466591   1/1  Mk.kkilaiIlAagkGtRl.p......pKpllpi.ggkpliehvleallksglideiivvtg...deeik
00520171   1/1  ----------------------------------------------------------------------
00493741   1/1  ----------------------------------------------------------------------
00525951   1/1  ----------------------------------------------------------------------
00503661   1/1  ----kmaaiilAAGkGtRmgs....dlpKqllkl.ggkpllehtleallslglidiivvvgneedlvlla
00513001   1/1  ----------------------------------------------------------------------
00501781   1/1  ----kmkavIlAaggGtRl.p......pKpllpiag.kPliahvleallaagideivvvtgd...eeiae
00405301   1/1  ----------------------------------------------------------------------
00463341   1/1  ----------------------------------------------------------------------
00485431   1/1  ----------------------------------------------------------------------
00468821   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00384621   1/1  ---MkvkavIlAaglGtRl.p......pKpllpiaG.kPliqhvieaalaagiidivvv.gtddeei.ed
00519161   1/1  ----------------------------------------------------------------------
00490571   1/1  ---pmkvaAiIlArGggkrl.p......pKnllplag.kpliaytleallasglideivVvtdddeiaev
00430231   1/1  ----------------------------------------------------------------------
00417961   1/1  ----------------------------------------------------------------------
00463331   1/1  ----------------------------------------------------------------------
00450161   1/1  ----------------------------------------------------------------------
00393191   1/1  ----------------------------------------------------------------------
00474111   1/1  ----------------------------------------------------------------------
00532691   1/1  ----------------------------------------------------------------------
00378411   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QLRQLNKLTENIILEPAGRNTAPAIALAALAATRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
00475151   1/1  ----------------------------------------------------------------------
00511921   1/1  ----------------------------------------------------------------------
00384271   1/1  eellgdgselglkivyvvepeplgtagalllaldll.....gddpfvlvlngDi.lidvd.laelleaar
00513641   1/1  esiedhlgdgselgldlklgglfvlllpanityvlepeplgtagalalaldllgd...spdepflvllgD
00406931   1/1  ieeylgdgselgvkityvlepeplgtagalllaldfl......gdepflvllgDhilldld.lrelleah
00473731   1/1  llgdgselglkvvyvlegeplgtadavllaleal......gddpvlvllgDrplidpd.ldelleahre.
00468771   1/1  ylgdgsllgvkityvlepeplgtagavllaldll......gddpflvllgDhplidld.laelleahr..
00481371   1/1  ellgdgselglevtyvlqgeplgtadavllaldal......gddpvlvllgDhplidpd.leelleahre
00503871   1/1  ellgdlg...irvvlqpgglgtagavllalealgd....gddlvlvldgDrplvdpelldrlieaa...a
00501951   1/1  llsklgv.evvyvvedealgtgplaavlaalellgd......dpvlvllgDhplldpedldrllealres
00435851   1/1  ----------------------------------------------------------------------
00380051   1/1  ll....glkvtyvvqpeplgtagavllaldalg....ddddpvlvllgDvplitdedldelleahle...
00502661   1/1  ll....lgldilivlqpgglgtagsvllalealgdl...dddpvlvldgDrpllspelldrlleaakes.
00441681   1/1  lgdgsellsdllldlklellellrllleglkityvlqgeplgtagavllaldllgd.....depvlvllg
00477071   1/1  llgd.ygvkivyvlqpeglgtagavllaldll.......dd.vlvllgDvpllld..lleahle......
00480191   1/1  ----------------------------------------------------------------------
00484841   1/1  ----------------------------------------------------------------------
00519391   1/1  ----------------------------------------------------------------------
00502051   1/1  ----------------------------------------------------------------------
00464661   1/1  likkl.glkviivlepeglgtadailaalkal......gddpvlvllgDvplidpdlidklleal.....
00513111   1/1  ----------------------------------------------------------------------
00530951   1/1  elglellnkmkaviLAGGlGtRLgp....slPKpllpvgngkpllehilerlkalqkkagikveiiivts
00387431   1/1  llgdg...nvtyvlqgeplgtagavllalellg....d.depvlvllgDvplvtpadlerllealaetg.
00500741   1/1  ----------------------------------------------------------------------
00508711   1/1  ----------------------------------------------------------------------
00447431   1/1  llak....lgirivlvegglgtggsvllalealgellll.depflvllgDaarplvspelldrllealee
00467871   1/1  ----------------------------------------------------------------------
00512501   1/1  ----------------------------------------------------------------------
00499121   1/1  ----------------------------------------------------------------------
00474101   1/1  ----------------------------------------------------------------------
00437061   1/1  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------
00475061   1/1  ----------------------------------------------------------------------
00516251   1/1  ----------------------------------------------------------------------
00388811   1/1  elladlg...ilivlvegglgtggsvllalealgd.....adpvlvldgDrplltpellerllealeehg
00431921   1/1  ----------------------------------------------------------------------
00466591   1/1  eylkklgiev..ilrikylqgdglgtadavllalkalgkd....ddpvlvllgDrplidpedidklieal
00520171   1/1  ----------------------------------------------------------------------
00493741   1/1  ----------------------------------------------------------------------
00525951   1/1  ----------------------------------------------------------------------
00503661   1/1  .........dkvvvvvegglgradsvlnaleal......dddivlvhdgdrplvspelidrllealkeag
00513001   1/1  ----------------------------------------------------------------------
00501781   1/1  algd.ygvevvyvrqdealgtggavlaalellad....gddpvlvllgDvPlitpelidrllealre...
00405301   1/1  ----------------------------------------------------------------------
00463341   1/1  ----------------------------------------------------------------------
00485431   1/1  ----------------------------------------------------------------------
00468821   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00384621   1/1  aldkyg..vevvltredalgtgdavlealell......gddpvlvlqgDvPlitpedldelleall...e
00519161   1/1  ----------------------------------------------------------------------
00490571   1/1  aekygaevvf.rpaelagdgagtadsvlaalealed.....ddivlvldadrpllspedidrllealre.
00430231   1/1  ----------------------------------------------------------------------
00417961   1/1  ----------------------------------------------------------------------
00463331   1/1  ----------------------------------------------------------------------
00450161   1/1  ----------------------------------------------------------------------
00393191   1/1  ----------------------------------------------------------------------
00474111   1/1  ----------------------------------------------------------------------
00532691   1/1  ----------------------------------------------------------------------
00378411   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
00475151   1/1  ----------------------------------------------------ylasggylwnsglflfna
00511921   1/1  --------IvPtlPetgygYilaglagelllig...ggvrrvlvfvekpslglaagii.rlapgegsglh
00384271   1/1  e...egalatvllvpvedptgygvvelded.........grvlsfvekpd........lagsnlansGiy
00513641   1/1  hli.dvd.lselleahre...sgalatllvvpvpledptgyGvielded.........grvlsfvEkpdl
00406931   1/1  re...kgalvtvllvpvedpsgygvvelded.........grvlrfvEkpd........epgsnlanaGi
00473731   1/1  ..sgadvtvlvvpvedptgygvvevded.........grvlefvekpdlpksn.lantgiyvfnpgvlll
00468771   1/1  .esgalatllvvpvedptgygvvelded.........grvlsfvEkpd........eprsnlanaGiyvf
00481371   1/1  ...sgadvtvlvvpvedptgygvvevded.........grvlsfvekpdlppsq........lanaGiyv
00503871   1/1  egg.avvlav.....pvgygvvvvded.........grvveivekpd............lnlantgqyfl
00501951   1/1  gadatllvvpvpdpepltgygy...gvvvldedg....rvlrfvekpdafraelll....yllnsgifle
00435851   1/1  ----------------------------------------------------------------------
00380051   1/1  sgadatvlvvpvedpsgygvvvlded.........grvlsfvekpdllaaqtps....nlantGiyvfdp
00502661   1/1  ..gaavtv.......ppgygtikldd...g.......rvleivekpd............llanqgpylfd
00441681   1/1  Dvpl..dedlaelleahre...sgaavtvvpvp..dpsgygvvvlde...g.......rvlsfvekpdre
00477071   1/1  sgalatvl.vkdp..tgygvvvlded..........grvlsfvekpd...........snlanagiyvfs
00480191   1/1  ----------------------------------------------------------------------
00484841   1/1  ----------------------------------------------------------------------
00519391   1/1  ----------------------------------------------------------------------
00502051   1/1  ----------------------------------------------------------------------
00464661   1/1  kgadatvlvvpvrdptgygvfkldllg.........kllsfvekpatdlasllalaglyvllvpglldll
00513111   1/1  ----------------------------------------------------------------------
00530951   1/1  yktaelikeylgdgsyfglkityvvqgkeplgtagalllaldfl......gddpflvlPdGnGD.iltdl
00387431   1/1  ....atilvvpvedptgygvvvld...dg.......rvleivekpdllaeqtpsn....laniGiyvfsp
00500741   1/1  ----------------------------------------------------------------------
00508711   1/1  ----------------------------------------------------------------------
00447431   1/1  dgaavtlv.........ppvygtikl..dedg.......rvveivekpd...........lnlantGqyf
00467871   1/1  ----------------------------------------------------------------------
00512501   1/1  ----------------------------------------------------------------------
00499121   1/1  ----------------------------------------------------------------------
00474101   1/1  ----------------------------------------------------------------------
00437061   1/1  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------
00475061   1/1  ----------------------------------------------------------------------
00516251   1/1  ----------------------------------------------------------------------
00388811   1/1  alallav.......pvgdygvvvldedg..........rvleivekpd...........lnlantGqyfl
00431921   1/1  ----------------------------------------------------------------------
00466591   1/1  kk...ngadavvlvvpvkdpngygvvldkdg..........lvlafvekpfpltrlqdl.pksylanggi
00520171   1/1  ----------------------------------------------------------------------
00493741   1/1  ----------------------------------------------------------------------
00525951   1/1  ----------------------------------------------------------------------
00503661   1/1  .....aailalpvkdtlkygdi...............................tldrdglwaaqtpqlfr
00513001   1/1  ----------------------------------------------------------------------
00501781   1/1  sgadaavlvvpvedpegygvpnvvkvvldedg....rvlgfvekpipltaerlllrrqdlpvsylinggi
00405301   1/1  ----------------------------------------------------------------------
00463341   1/1  ----------------------------------------------------------------------
00485431   1/1  ----------------------------------------------------------------------
00468821   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00384621   1/1  sgadivvlvvevddpillalpgygvv........vlded.grvlyfvekpipyrrqdlap..sylinggi
00519161   1/1  ----------------------------------------------------------------------
00490571   1/1  ..sgadgailvvpvsdtlkrgvvldedg..........rvlalvekpl.arartqdlfrlyllnggiyil
00430231   1/1  ----------------------------------------------------------------------
00417961   1/1  ----------------------------------------------------------------------
00463331   1/1  ----------------------------------------------------------------------
00450161   1/1  ----------------------------------------------------------------------
00393191   1/1  ----------------------------------------------------------------------
00474111   1/1  ----------------------------------------------------------------------
00532691   1/1  ----------------------------------------------------------------------
00378411   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
00475151   1/1  sllleeldalapeildsacrpalldaledldfirseggvrrvldlenflacpgisidyavlePgalalph
00511921   1/1  rhr...................................daeevfyvleGegrltddgekirlkpGdvfll
00384271   1/1  vfdas.lldlleelaps........................afgeleltdvlyallekglrvvavlgdgf
00513641   1/1  etaeeylalglllllsllllepksnlansGiyvfspevlldlleelapgge...................
00406931   1/1  yvfspe.vldlleellps.......................argelfltdvidylleegllkvyaypfdg
00473731   1/1  llelllsalgeleltdilrallaaglkvyavlld.gyewldvgtpedlleaeidlavrekrlglavvdpe
00468771   1/1  spevl.dlleelkpsargelf.......................ltdvidlllaegllkvyaypldgywl
00481371   1/1  frpd.vldaleelapsalgele.......................ltdiidllleeglkvaavlgdgfew
00503871   1/1  spllldalekaargelelt...........................dilslllelglkvvvvpgdgfwld
00501951   1/1  atsdlanagiyvfspevleale.............nldidtledlelaeillall.kggkvyavlldgye
00435851   1/1  ----------------------------------------------------------------------
00380051   1/1  e.lldallellps.......................dgargelyltdvislllaaglkvlaveldgywld
00502661   1/1  aelllealr................................gelyltddlallekaglkvavvegdgewl
00441681   1/1  .........sllanagiyvfspe.lldllle.rgely.............................ltdv
00477071   1/1  pevf.dllkelleell...................kpgargelyltdilaallekglkvvavlldgywld
00480191   1/1  ----------------------------------------------------------------------
00484841   1/1  ----------------------------------------------------------------------
00519391   1/1  ----------------------------------------------------------------------
00502051   1/1  ----------------------------------------------------------------------
00464661   1/1  kdidtpedlel-----------------------------------------------------------
00513111   1/1  ----------------------------------------------------------------------
00530951   1/1  d.lsklldfhle.sgadatlvvnvdnlvpvadpsryGvveldg.........lgrvtkfveKpklp....
00387431   1/1  evldallelllkp...........................gargeleltdllsllleaglkvlavlgdgf
00500741   1/1  ----------------------------------------------------------------------
00508711   1/1  ----------------------------------------------------------------------
00447431   1/1  ls.plllealea.ggeiy.............................ltdllslleaaglkvlavegdgl
00467871   1/1  ----------------------------------------------------------------------
00512501   1/1  ----------------------------------------------------------------------
00499121   1/1  ----------------------------------------------------------------------
00474101   1/1  ----------------------------------------------------------------------
00437061   1/1  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------
00475061   1/1  ----------------------------------------------------------------------
00516251   1/1  ----------------------------------------------------------------------
00388811   1/1  s.palldalealaggelyltdllslleaaglrvlavegdgewldigtpe---------------------
00431921   1/1  ----------------------------------------------------------------------
00466591   1/1  yifdasvllk...........................................lralengkkvavvlgdg
00520171   1/1  ----------------------------------------------------------------------
00493741   1/1  ----------------------------------------------------------------------
00525951   1/1  ----------------------------------------------------------------------
00503661   1/1  lellleal...........egeyyltd.....................dasllealglkvalvegdeeni
00513001   1/1  ----------------------------------------------------------------------
00501781   1/1  yafrpelllallegargeleltdvlellralaaggrvaavevdglaw-----------------------
00405301   1/1  ----------------------------------------------------------------------
00463341   1/1  ----------------------------------------------------------------------
00485431   1/1  ----------------------------------------------------------------------
00468821   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00384621   1/1  yvfrpeillallellpgaleeiellealrllaaggrvlayevdgewldvdtpedl---------------
00519161   1/1  ----------------------------------------------------------------------
00490571   1/1  k.daldealaleggkvvalvlgdernid....................idtpeDlalaelllkelgil--
00430231   1/1  ----------------------------------------------------------------------
00417961   1/1  ----------------------------------------------------------------------
00463331   1/1  ----------------------------------------------------------------------
00450161   1/1  ----------------------------------------------------------------------
00393191   1/1  ----------------------------------------------------------------------
00474111   1/1  ----------------------------------------------------------------------
00532691   1/1  ----------------------------------------------------------------------
00378411   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRHAVQDVKK
00475151   1/1  yhnaeelfyvleGrgrltvvdpggkqkvvavrpGDviwlPaGvwhslqnlgdgdllllvfldgpfsengl
00511921   1/1  Pagishdlanlgdtpglll......wsldgslsala..................................
00384271   1/1  awldvgtpedlleaeallatl.elrqgllladpeeiairsglilaedllilalvllksgygiyll-----
00513641   1/1  .......lfltdilpallekglrv----------------------------------------------
00406931   1/1  ywldvgtpedlleanallllllarlglyialleiialvlglipaklllllavdllivgy-----------
00473731   1/1  ivisdlgligalvlisviggnvkigygv------------------------------------------
00468771   1/1  dvgtpedlleanalllsglaliglvliipesvigrgvvigpgvvisvildgvri----------------
00481371   1/1  ldvgtpedlleaealllsrlv.rlgvllldpeniyirsgv.....iigddlv........ilvnvligng
00503871   1/1  vgtpedlalaeallq-------------------------------------------------------
00501951   1/1  wldvgtpedlleaeallls---------------------------------------------------
00435851   1/1  --------------------------------------------------------Mlvallsdledvkd
00380051   1/1  vgtpedlleaealllkrlaelglllgv-------------------------------------------
00502661   1/1  dvgtpedlalaeallke-----------------------------------------------------
00441681   1/1  lplllaagkvyavpldgywldv------------------------------------------------
00477071   1/1  vgtpedlleaeal---------------------------------------------------------
00480191   1/1  ----------------------------------------------------------------edlqdv
00484841   1/1  -------------------------------------------------------------------Mvk
00519391   1/1  ----------------------------------------------------------------------
00502051   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00513111   1/1  -----------------------------------------------------llavlvapkmkvvnlke
00530951   1/1  ........a-------------------------------------------------------------
00387431   1/1  wldvgtpedlllaeallllrlaelgll-------------------------------------------
00500741   1/1  ----------------------------------------------------------------------
00508711   1/1  ----------------------------------------------------------------------
00447431   1/1  widvgtpedllla---------------------------------------------------------
00467871   1/1  ----------------------------------------------------------------------
00512501   1/1  ----------------------------------------------------------------------
00499121   1/1  -----------------------------------------------------------------lpyll
00474101   1/1  -----------------------------------------------------------------egepy
00437061   1/1  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------
00475061   1/1  -------------------------------------elyigpgllpldfsldslvppkpdvrrlpdlkp
00516251   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00431921   1/1  --------------------------------------------------------------ffledlle
00466591   1/1  lwldidtpedlela--------------------------------------------------------
00520171   1/1  ----------------------------------------------------------------------
00493741   1/1  ----------------------------------------------------------------------
00525951   1/1  ---------------------------------------------------------------------p
00503661   1/1  kittpeDlalaeall-------------------------------------------------------
00513001   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00405301   1/1  ----------------------------------------------------------------------
00463341   1/1  ----------------------------------------------------------------------
00485431   1/1  ----------------------------------------------------------------------
00468821   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00519161   1/1  ----------------------------------------------------------ealdplalqdli
00490571   1/1  ----------------------------------------------------------------------
00430231   1/1  ------------------------------------------------------------------dvee
00417961   1/1  ----------------------------------------------------------------------
00463331   1/1  ----------------------------------------------------------------------
00450161   1/1  --------------------------------------------lleklvevnplllklldtgglrdefl
00393191   1/1  ----------------------------------------------------------------------
00474111   1/1  ----------------------------------------------------------------------
00532691   1/1  ----------------------------------------------------------------------
00378411   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
00475151   1/1  vlggdvlagfsknvlaaafgvdeelvarlgledlvivdtpdavlvapkdnglpvkvivarlkfnlle...
00511921   1/1  ......vplvelfdhatsisrklegvsldkiAealgvdliefldeilpllvadkdrsqdvpelvkplvlr
00384271   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00481371   1/1  vglyllslle------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00435851   1/1  pvvvvrageraellaegggvrrrvllspslgagegfevglvtlePGa....plHrHpgeefvyVleGege
00380051   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00477071   1/1  ----------------------------------------------------------------------
00480191   1/1  plvvnl..ddlepefldeggvsrplllsdelpglgglsvglvtlpPGartppHrH.paeevlyvleGege
00484841   1/1  rivdllpaavrpeldpgggvrrrlllpppllgggglsvalvtlppGarlppHrHpgedevlyvleGegev
00519391   1/1  ---------klnlveplpvfrgggvvrvllpsegfsvvlvtlppGgelplhthpg.eevvyvleGeatlt
00502051   1/1  MivpnlvridllellvsgtggvsrrllapllggkglsvklvtlppGarlplHrHp.geevlyvleGegev
00464661   1/1  ----------------------------------------------------------------------
00513111   1/1  lvpll...............rgggsyrvllpgkglevvlvtlppGaelpphsHpg.eellyvlsGelevt
00530951   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00500741   1/1  ---------------mivvrlddlpdvlrpgvsyrlllpgdglsvvlvtlppGarlplhrHpgaeevlyv
00508711   1/1  -------------htpksvlalnfgvltealappppderrlsdlkpvvadpealeqlpvetpggvvrvll
00447431   1/1  ----------------------------------------------------------------------
00467871   1/1  -----ldpdllqdfcvadllaslvlvdglpckpklvtandfvfnlllssppdtynpeggrvtellsldlp
00512501   1/1  -------------svdgdggytyrllapllggkglevflvtlppgaslslpphthpgeEflyVleGelel
00499121   1/1  nllspapvvssegGrirvlnsflenlpilrtleglsvvrvtlkpggllpphyh.dadeilyvleGegrvt
00474101   1/1  vfnllsfapvvspeagrirvlevndedlpllkgleglsvvrvtlepggllpph.hhdadeilyvleGrgr
00437061   1/1  --------------MtLqkiavalgvslsalftepapdpepvvvvpadelrsilapplalggggrvrrll
00476861   1/1  -----mvllldlapdsprpvviragdlpplvepggglvrvlllfdp..tggglsvglvrlppGggfpppp
00475061   1/1  vlfdvdlleatpeespggtvrvllsppllgsg.glsvglvtlpPGgvgneyvttplHyHprldadEvyyv
00516251   1/1  --------------------sllsllddseldlplplisdlkviadvlgplgvlferldaddlvppdlds
00388811   1/1  ----------------------------------------------------------------------
00431921   1/1  peavvrkadrlilvpegdvkellpgtggvrlklllspllgggfeaglvtlpPGgs.ssppHrHpgseeff
00466591   1/1  ----------------------------------------------------------------------
00520171   1/1  --------------------epldelvvvragervvvvrlagegggytyellapglggkglepflvtlpp
00493741   1/1  ---------------------------------Lgvplstlfaepedeavvvrkgevtsivpgdggvryr
00525951   1/1  rvivlreadlpwlpfgg.gvrrvllslpglgalglsvalvtlppGartppHrHp.geevlyvleGegrvq
00503661   1/1  ----------------------------------------------------------------------
00513001   1/1  -------------------------------tmmlmkpinlkkwleenrelllppvggkligsgnlsvvl
00501781   1/1  ----------------------------------------------------------------------
00405301   1/1  ----------------eggpvrrrlllpllelgglsaglvelepga.p..hhhhdaeelvyvleGegevt
00463341   1/1  ----------------------------------lsvvlvtlepgglllphyh.dadevvyVleGegvvt
00485431   1/1  --------GleeplckaglpfvlnllspapvvsneaGsvrvldvlnlpilnglglslarvtlepggllpp
00468821   1/1  ------------------lckmklpfvfnllspapvysnegGrvrvlnvldlpilnglglslarvtlepg
00502971   1/1  --------------Msrllyyddspgdprlpllvlpdipvilellaelgvlferleaddaalevwldrlv
00384621   1/1  ----------------------------------------------------------------------
00519161   1/1  ralrallgedlvdllalldlllplllnpddllpfarpdpgrytrnllyepnggfslvlfvwppGqatplH
00490571   1/1  ----------------------------------------------------------------------
00430231   1/1  lldvldfelvpplilllllllggvlltylvpvpeFavlrltlsggl...lllsldgfelllvleGegtit
00417961   1/1  ---------------------necrpfnlsalepaglisneggsvtelnpnlpqlnglgvsvarvtlepg
00463331   1/1  -------------------------------klpfnlddlepvvenegGrvtelnvenlpilnglglsaa
00450161   1/1  ievlvtpeeagltyvgfdrlvlgGvvplg........keltleeaegeglsldlflerrElgivllgGkg
00393191   1/1  ----------------------lgvdgpvkirtdlllldvtlppgasltlhlhagreeflyvleGevevn
00474111   1/1  ---------------------------------glsaarvtlepgglllphyhpnadeilyvleGrgrvg
00532691   1/1  ---------------------------------gvsvarvtlepgglllphyhpnaheilyvleGegrvg
00378411   1/1  ------------------rievlnsnlpqlrclgvsaarvtlepgalllphy.hnadevlyvleGegrvg


                         -         -         +         -         -         -         -:490
query           INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI------------
00475151   1/1  .advvnrpggrvtildsgnfpilnglsvarvtlkpGamlsphwHpnaeevlyvlsGt-------------
00511921   1/1  adegppvnpgggvyrpllspddg..gggfsvglvtlpPGarlppHtHpgaeevlyVle------------
00384271   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00435851   1/1  vtvggetyelkaGDsvyiPagvpHrlrntgdeparllvvftpplfgelvpelvlgnr-------------
00380051   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00477071   1/1  ----------------------------------------------------------------------
00480191   1/1  vtlgdgggklvgkleevelkpGdvvyiPpgvpHrlrnlgdteplvllvvftppl...d------------
00484841   1/1  tlggeevvlkaGdviyipagvpHrlrntgdepavllvvft------------------------------
00519391   1/1  ledgetvelkaGdviyipagvpHrlrnlgdeplvllvvfsppylged-----------------------
00502051   1/1  tlggeevelkpGdviyipagvpHrlrnlgdepavllvvl........pivrl------------------
00464661   1/1  ----------------------------------------------------------------------
00513111   1/1  ldgetyllkaGdsiyipagvpHrlrnlgdeplrllvvftp------------------------------
00530951   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00500741   1/1  leGelevtlggeevvlkaGdviyipagvpHrlrnlgdepavl----------------------------
00508711   1/1  stelpgsgglsvglvtlpPGgvggEyfrtplHyHpdldaeEvyyvlsGegrvtlgge-------------
00447431   1/1  ----------------------------------------------------------------------
00467871   1/1  lleglglsvarvtlpPGgrlppHyHpgaeevfyVleGegrvtvvdpgclgg-------------------
00512501   1/1  tlggetvtlkaGdslyfpagvpHrlrnlg.eparllvvvtpp........--------------------
00499121   1/1  lvdpgggetfelkaGdvlviPaGtphylintdgdeplvllavftpanlpedflr----------------
00474101   1/1  vtlvdpgggeefelrpGDviviPagtphslvnpgedeplvllaifdppn..tdglfrr------------
00437061   1/1  spalggakglsvglvtlpPGgespepHtHpdgeevfyVleGeleltlggetyelk---------------
00476861   1/1  HrHpdaeellyvleGegrltlgdgggpeeevvlepGdvvyiPaGvpHsfrnlgd.p--------------
00475061   1/1  leGegrvtlggeegetrevelkpGdvvyvPpgvpHrvvntgdeplvflaifdppafe-------------
00516251   1/1  glplllyrealdrlvaeggylirdlvtlggssvnvelppgaflppHtHpddEvf----------------
00388811   1/1  ----------------------------------------------------------------------
00431921   1/1  yVlsGegtvtvdgetytlkaGDslyiPpgvpHrfrntgdeparvlavftppg------------------
00466591   1/1  ----------------------------------------------------------------------
00520171   1/1  gartpplelhsHegeEflyVleGelelrlgdeeeyepvv-------------------------------
00493741   1/1  llappltgaglelylvtlppGgesppphhhhggeEflyVl------------------------------
00525951   1/1  vvggetvvlkaGDviviPpgvpHwfrntgdeplvllvvftpplggvvdwl--------------------
00503661   1/1  ----------------------------------------------------------------------
00513001   1/1  vvlepGartppHyHp.geevfyvleGegrltlgdegeartvdlkaGDvfli-------------------
00501781   1/1  ----------------------------------------------------------------------
00405301   1/1  vedgevvvlkaGDvvvfpagvphrlrnlgdepavylv---------------------------------
00463341   1/1  vvdpdggeeyrlkeGDvivipagvphylvnpdgdepl---------------------------------
00485431   1/1  HyHpnadeilyvleGegrvgvvdpngdetfektlkaGdvfviPa--------------------------
00468821   1/1  gllppHyHpnadeilyvleGegrvgvvdpdggevfdkelkaGdvfviPa---------------------
00502971   1/1  aergylsvdlitlspdsvalvelppggflppHrHpd.dEvl-----------------------------
00384621   1/1  ----------------------------------------------------------------------
00519161   1/1  dHpgawevvkvleGeltvtlydwvddglrplklvgevvlgaGdvivlppgldiHrvrN------------
00490571   1/1  ----------------------------------------------------------------------
00430231   1/1  vggkeltlkaGdsffipagveh.ltvegdgrllialv---------------------------------
00417961   1/1  glllph.hhdaeeilyVleGegrvglvlpgcpetfnesqee-----------------------------
00463331   1/1  rvtlepgglllphyhpnadeilyvleGegrvgvvdpgge-------------------------------
00450161   1/1  tvtvdgevfelgpgdalYvpkg------------------------------------------------
00393191   1/1  gggeelvlgagdllvlpagvphslrnaadeparfl-----------------------------------
00474111   1/1  vvdpggnevfdeseelrdehqkvrarlreGdv--------------------------------------
00532691   1/1  vvgpggretfedyhlfsarlreGdvfviPagvphylvnngdl----------------------------
00378411   1/1  vvlpggrevfddqqqqseqeqeerfrdvdqkvrrlreGdvvvvPagvphwlyndgdeplv----------