[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF70471.1


[Show Plain Result]

## Summary of Sequence Search
   1::94
   1::94   2.3e-29 46.8% 0036409 00364091 1/1   omal protein L25-like                   
   1::94   2.4e-23 43.7% 0037515 00375151 1/1   omal protein L25-like                   
   1::94


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
00364091   1/1  lltleaelReelgkgaarrlRreglvPAvlYggglepvsialdlkellkllrkagflntlltLevdgkkv
00375151   1/1  etleleaelReelgk...rrlRreglvPAviYggg.epvsialdakellkllrsegflstllelevdgkk


                         -         -         *         -         -         -         -:140
query           KVKAQAVQRHAYKPKLTHIDFVRA----------------------------------------------
00364091   1/1  lvlvkdvqrhpvkdlllHvdFlrv----------------------------------------------
00375151   1/1  vlvlvkdvqrdpvkdlilHvdflr----------------------------------------------