[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF54777.1


[Show Plain Result]

## Summary of Sequence Search
   1::605
   4::334  PF01757 0.0% 21.1920529801325  Acyltransferase family 
   1::605


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIKWFSLVRITGLLLVLLYHFFQTIFPGGFFGVDVFFTFSGFLITALLIEEFSKNHEIDLIGFFRRRFY
PF01757         ---hylDllRgiAillVvflHvliayspdagrgspiqasqssqiflgsfgvplFFllSGffla......a


                         -         -         *         -         -         -         -:140
query           RIVPPVVLMVLVTMPFTFLVRQDYVAGIGGQIASVLGFMTNFYELLTGGSYESQFIPHLFVHNWSLAVEV
PF01757         mlyrrrglsklikrRilrllipfliwllliilliwlvaghiqanasanvtlfdet.........kglmfl


                         +         -         -         -         -         *         -:210
query           HYYILWGLAVWFLSKQAKSNGQLKGMVFLLSAVAFLISFFSMFIGSFLVTSYSSVYFSSLTHVYPFFLGS
PF01757         lfefpatghlWfLpalfvlylllplllrllrkvrsshlllllilllllslvfirhelfgpatsvgllplp


                         -         -         -         +         -         -         -:280
query           MLATIVGVRQTTSLVKQLDKIWDLRKTLVVFGGGFGFLVLLTFFVKFTYLFAYLIGFLLASLAALAMILA
PF01757         svla.....llfflfGallgdaddrdrnlsr.......glkislllslallalillalfgqtdggglvas


                         -         *         -         -         -         -         +:350
query           ARVLHEKTHHIQEPKIISFLADTSYAVYLFHWPFYIIFSQLTSNLLAVLLTLICSYGFASLSFYVLEPWI
PF01757         vliqsasllllslgimllllllfalpsrsalk..pllrylgkiSygiYliHlpl----------------


                         -         -         -         -         *         -         -:420
query           AGKNTPIVQTLRPLPYIHAILAAGTGILTIIVCTVTLLAPQVGAFETDLTVNGLKQAATNIGQTKVMAER
PF01757         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ADANSLGIADGTMLIGDSVALRANTALQTALPGAQINAQVSVTTKTANEIMLNNSQNKFLPKTVVIATGV
PF01757         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           NNPENYKDDWDSIVKNLPKGHHMILVTPYEGDKTKETYAIVEKAAAYMRELAEKTPYITIADWNQVAKEH
PF01757         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PEIWAGTDQVHFGSESSTIEAGAKLYADTIATALQTAQDKPVKSK-------------------------
PF01757         ----------------------------------------------------------------------