[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF54781.1


[Show Plain Result]

## Summary of Sequence Search
   1::676
 160::243  PF07242 0.0% 26.3157894736842  Protein of unknown function (DUF1430) 
 576::675  PF07242 0.0% 41  Protein of unknown function (DUF1430) 
   1::676


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRLFILISMVLVSLYMVITSVDHREEILFGNYPSVDVTGMMTNQPVASREEVTEALSHLAVEHNSLIAR
PF07242         ----------------------------------------------------------------------
PF07242         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RIVEPNEAGETRFTYATYGEGELPEGLTISSKESAETSDLLGSYLIVSGSLDGVSLQTTLKELGYQGFVS
PF07242         ----------------------------------------------------------------------
PF07242         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NGEDPFSIVLLLTATPMVLLSLAIFLLTFMSLTLIYRIKSLRQAGIRLIAGESLFGVALRPVLEDVRQLI
PF07242         -------------------lllalslllivqlvllYFeqfkkkllikkihGyslf........krhkeyl
PF07242         -------------------lllalslllivqlvllYFeqfkkkllikkihGyslf........krhkeyl


                         -         -         -         +         -         -         -:280
query           CSVLVSSLLGLGILWYQGALFMATVQLVIIALLLYGLTLAGISTLLSVVHLLGLQENSLVDLLKGKLPLK
PF07242         iiqlivlviililifiltkekiillvvlvllli-------------------------------------
PF07242         iiqlivlviililifiltkekiillvvlvllli-------------------------------------


                         -         *         -         -         -         -         +:350
query           RMMTLMMVGQLLAVLVVGSSATALLPHYREMQEMERASNKWSQSSDRYRLSFGWSSAFADEEGTRKDNRE
PF07242         ----------------------------------------------------------------------
PF07242         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           WQTFTEERLANTDSFYIMSNVDNFSDGAEVDLDGNRLSDYTPSGNVIYVSPRYLIEEKITVSSEFMDKMQ
PF07242         ----------------------------------------------------------------------
PF07242         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NLSEGEFGLILPESLREQSVYYQGLFTDYLQNFSSESVEVTSQKHYLPQVRLAFTETGQERFLYNDGYKT
PF07242         ----------------------------------------------------------------------
PF07242         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TRQYLKDPIIVVLTPQATGTRPVAGMLWGTTANSALKLDRYGDSITALKEQGLYHKVSYLVKSQLFFAKV
PF07242         ----------------------------------------------------------------------
PF07242         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LNDKRVEFYSLLIGTILTLSTAILLFDSMNLLYFEQFRRELMIKRLAGMTIYELHGKYLLAQGGVLLLGL
PF07242         ---------------illlalslllivqlvllYFeqfkkkllikkihGyslfkrhkeyliiqlivlviil
PF07242         ---------------illlalslllivqlvllYFeqfkkkllikkihGyslfkrhkeyliiqlivlviil


                         -         +         -         -         -         -         *:700
query           VLSSILTRDGLISALVVALFTLNALLILVRQDKKEEAGSMAVLKGK------------------------
PF07242         ilifiltkekiillvvlvlllielllillvqekiekkkfievlKG-------------------------
PF07242         ilifiltkekiillvvlvlllielllillvqekiekkkfievlKG-------------------------