[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF54875.1


[Show Plain Result]

## Summary of Sequence Search
   1::738
 290::687  PF02065 0.0% 53.6895674300254 PF02065 Melibiase 
   1::738


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVSFSEEFEDIQQ
PF02065         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQDFELEKGKNRLNSLPSTFDDIGQCAETLTIILTD
PF02065         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAMSLQLDLPDSQYDFIQFSGAWLRERQLYRTS
PF02065         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LRPGIQAIDSLRYSSSPQQNPFFMLSRRETTEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVE
PF02065         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FRFLLNPAESFVTPEAIVIYSDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKIL
PF02065         ---------sfqtpelvavysdkGlngvsqkyhellrkrlvrskfaekerpvllnnWeavyfdfnedkll


                         -         -         -         -         *         -         -:420
query           DLAKAAKDLGIELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
PF02065         eladeakdlGvelfvlDDgWfgeRnddnasLGdwvvdeekfPnGlkaladkvhekglkFGlwvEPEmvsa


                         -         -         +         -         -         -         -:490
query           DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDMNRHITDIYSI
PF02065         dsklyrehPdwvlkvadrsrslgRnqlvldlskpdvvdyiieelaqllaeakidYvKwDnnrnlteigsp


                         *         -         -         -         -         +         -:560
query           ELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMYYAPQAWTSDDTDPIERLKIQ
PF02065         ele.....eaahryilglYrlldaLkkafpkilfesCssGGgRfDlglleyapqiWtSdntdaveRlkiq


                         -         -         -         *         -         -         -:630
query           HGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFSSFGYELDVTRLSVEEKEQVREQIQFYKKYR
PF02065         igtsllyppsaigaHvsavpnhqtgrktsletraavalfgslglEldvakltdeekkavkelvalykkvr


                         -         +         -         -         -         -         *:700
query           SLFQYGDFYRINSPFSCDSASWQVVSKDKCQSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFF
PF02065         elvakgtlyrlkspeesnqvaklivsedkkealvlytqllakaekeeqvvkLkgLda-------------


                         -         -         -         -         +         -         -:770
query           YGDELMNAGIKVSLSNLALCVPEYLTKLFVIEEVVCKY--------------------------------
PF02065         ----------------------------------------------------------------------