[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF54887.1


[Show Plain Result]

## Summary of Sequence Search
   1::99
   6::85   PF02699 0.0% 35.8974358974359  Preprotein translocase subunit 
   1::99


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKGTIVLDVD
PF02699         -----ssllplvllfvifyfllirpqqKrqkehkemlssLkkGdeVvtsgGivGkivki..eddtvvlei


                         -         -         *         -         -         -         -:140
query           GVYLTFELAAIKTVLPLKETASLEGAIEK-----------------------------------------
PF02699         aegvkvkveksaiak-------------------------------------------------------