[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55075.1


[Show Plain Result]

## Summary of Sequence Search
   1::145
   1::82   PF02082 0.0% 37.8048780487805  Transcriptional regulator 
  10::59   PF02002 0.0% 26.530612244898  TFIIE alpha subunit 
   1::145


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDL
PF02082         MklsskteyalhallyLakeeeeepvsseeiaerqnispvylekilakLrkaglvksvrGkgGGyrLarp
PF02002         ---------eeavlvldvll.rkgevteedlaeelkidlnelRklLakLydakLvkyrr-----------


                         -         -         *         -         -         -         -:140
query           KDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVADAE
PF02082         peeItlldvvra----------------------------------------------------------
PF02002         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SQMKD-----------------------------------------------------------------
PF02082         ----------------------------------------------------------------------
PF02002         ----------------------------------------------------------------------