[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55106.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
  44::269  PF08245 0.0% 22.2857142857143  Mur ligase middle domain 
 296::375  PF02875 0.0% 27.8481012658228  Mur ligase family, glutamate ligase domain 
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIGGTNGKGSTIAFLKKMLEKLGLRVGV
PF08245         -------------------------------------------iTGTnGKTTtteliaallkaagktvgt
PF02875         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FSSPYLIHYTDQISINGESISEARLEALMADYQSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAI
PF08245         ag............................................ntnneiglpallaeleekeadvav
PF02875         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MEVGMGGLLDSTNVCQPILTGITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRI
PF08245         lElSsfglgekqlegl..lkpdiavitnitedHldyh.gtmenyaaaKsklfenlkekgiavvnadde..
PF02875         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AEEKDAPRLAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGRE
PF08245         .alaeaakkkkak.vvtfgleeeadleaanlevseeggkielvkvkgeeleiklplpGr-----------
PF02875         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADHHKEILFTCIKTKALED
PF08245         ----------------------------------------------------------------------
PF02875         ---------------vkgRlevvgeangvtvidDyahnpdslsaalkalreiapdkrlilvfgpggelge


                         -         -         -         -         *         -         -:420
query           MLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQNLTDKKEEKQTVRIVTGSLYF
PF08245         ----------------------------------------------------------------------
PF02875         rtrefhdefgrlasalads.lvvlg---------------------------------------------


                         -         -         +         -         -         -         -:490
query           LSQVRAYLMERKNENGYTKD--------------------------------------------------
PF08245         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------