[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55169.1


[Show Plain Result]

## Summary of Sequence Search
   1::347
 117::346  PF00198 0.0% 49.1228070175439  2-oxoacid dehydrogenases acyltransferase (catalytic 
   5::41   PF02817 0.0% 56.7567567567568  e3 binding domain 
  49::85   PF02817 0.0% 43.2432432432432  e3 binding domain 
   1::347


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIALEHNIAWQEIQ
PF00198         ----------------------------------------------------------------------
PF02817         ----rvfasPaaRkLAaekgidLsqvkGTGpgGRItkeDVe-------vfasPaaRkLAaekgidLsqvk
PF02817         ----rvfasPaaRkLAaekgidLsqvkGTGpgGRItkeDVe-------vfasPaaRkLAaekgidLsqvk


                         -         -         *         -         -         -         -:140
query           GTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGKIERIPMTPMRKVIAQRMVESYLT
PF00198         ----------------------------------------------eeervplsgirkaiakrlteskqt
PF02817         GTGpgGRItkeDVea-------------------------------------------------------
PF02817         GTGpgGRItkeDVea-------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           APTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNY
PF00198         iPhftlsdevdvtallalrkklke.deakeekkltlldflikavalalkefPelnssvdeek.eivlkks
PF02817         ----------------------------------------------------------------------
PF02817         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VNLAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGP
PF00198         vnigiAvatpdGLlvPviknadkkslleiakelkdlaeraregklkpeeleggtftisNlGmlGvtsftP
PF02817         ----------------------------------------------------------------------
PF02817         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI---
PF00198         iinppqvaIlavgrikerpvvkegeivirkvmtlslsaDHRvidGaeaarFlntlkellenperll----
PF02817         ----------------------------------------------------------------------
PF02817         ----------------------------------------------------------------------