[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55178.1


[Show Plain Result]

## Summary of Sequence Search
   1::543
 255::316  PF03793 0.0% 44.2622950819672  PASTA domain 
 324::389  PF03793 0.0% 32.7868852459016  PASTA domain 
 397::461  PF03793 0.0% 35  PASTA domain 
 466::535  PF03793 0.0% 33.3333333333333  PASTA domain 
   2::143  PF00069 0.0% 33.3333333333333  Protein kinase domain 
   3::142  PF07714 0.0% 24.8175182481752  Protein tyrosine kinase 
   1::543


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARG
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF00069         -lqilegleylHsngiiHrDLKpeNiLldkkgelkiaDFGlakkl.eksseklttlvgtreYmAPEvllk
PF07714         --qiAkGmeyLeskklvHrdLaarNvLleeekvvkisDfGLardiekddyykkkeeaklpvkWmapEslk


                         -         -         *         -         -         -         -:140
query           SKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLT
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF00069         akeytkkvDvWslGvilyelltgklpfsgeseedqleliekilkkkleedepkssskseelkdlikklle
PF07714         ekkftsksDvWsfGvllwEiftlgespypglsneevlell.ke..gkrlekpekcpeelyelmkqCweee


                         +         -         -         -         -         *         -:210
query           NRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVSQSTLTSIPKVQAQTEHKSIKNPSQAV
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF03793         ----------------------------------------------------------------------
PF00069         kdp-------------------------------------------------------------------
PF07714         pe--------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TEETYQPQAPKKHRFKMRYLILLASLVLVAASLIWILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGE
PF03793         --------------------------------------------tvPdvtGmsvdeAkatLkalGlkikt
PF03793         --------------------------------------------tvPdvtGmsvdeAkatLkalGlkikt
PF03793         --------------------------------------------tvPdvtGmsvdeAkatLkalGlkikt
PF03793         --------------------------------------------tvPdvtGmsvdeAkatLkalGlkikt
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EKTEASEKVEEGRIIRTDPGAGTGRKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIK
PF03793         vee.tsddvpeGtVisQsPeaGtevskgskvtltvs-------vPdvtGmsvdeAkatLkalGl...kik
PF03793         vee.tsddvpeGtVisQsPeaGtevskgskvtltvs-------vPdvtGmsvdeAkatLkalGl...kik
PF03793         vee.tsddvpeGtVisQsPeaGtevskgskvtltvs-------vPdvtGmsvdeAkatLkalGl...kik
PF03793         vee.tsddvpeGtVisQsPeaGtevskgskvtltvs-------vPdvtGmsvdeAkatLkalGl...kik
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IEEEESNESEAGTVLKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENL
PF03793         tveetsddvpeGtVisQsPeaGtev.sk.gskvtltvsk-------PdvtGmsvdeAkatLkalGl...k
PF03793         tveetsddvpeGtVisQsPeaGtev.sk.gskvtltvsk-------PdvtGmsvdeAkatLkalGl...k
PF03793         tveetsddvpeGtVisQsPeaGtev.sk.gskvtltvsk-------PdvtGmsvdeAkatLkalGl...k
PF03793         tveetsddvpeGtVisQsPeaGtev.sk.gskvtltvsk-------PdvtGmsvdeAkatLkalGl...k
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IKIEEEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLIQIVGIK
PF03793         iktveetsddvpeGtVisQsPeaGtevsk..gskvtltvsk----vtvPdvtGmsvdeAkatLka.lGl.
PF03793         iktveetsddvpeGtVisQsPeaGtevsk..gskvtltvsk----vtvPdvtGmsvdeAkatLka.lGl.
PF03793         iktveetsddvpeGtVisQsPeaGtevsk..gskvtltvsk----vtvPdvtGmsvdeAkatLka.lGl.
PF03793         iktveetsddvpeGtVisQsPeaGtevsk..gskvtltvsk----vtvPdvtGmsvdeAkatLka.lGl.
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EANIEVVEVTTAPAGSAEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP-----------------
PF03793         ..kiktvee..tsddvpeGtVisQsPeaGtev.skgskvtltvsk-------------------------
PF03793         ..kiktvee..tsddvpeGtVisQsPeaGtev.skgskvtltvsk-------------------------
PF03793         ..kiktvee..tsddvpeGtVisQsPeaGtev.skgskvtltvsk-------------------------
PF03793         ..kiktvee..tsddvpeGtVisQsPeaGtev.skgskvtltvsk-------------------------
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------