[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55228.1


[Show Plain Result]

## Summary of Sequence Search
   1::230
   2::227  PF01048 0.0% 36.1607142857143  Phosphorylase superfamily 
   1::230


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDA
PF01048         -kiaiivgspgevallaespleetpygregrggkfvtGtlkgkpvvlvstGiGkpnaaviatarllkefg


                         -         -         *         -         -         -         -:140
query           LINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNW
PF01048         vkaiirtGtaGglnpdlkvGdvvipddainfdgtsplygpkeegegapdvaeakadpellallkeaaeal


                         +         -         -         -         -         *         -:210
query           HFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHALNLPVLVIRAMSDNANHEANIFFDEF
PF01048         gikvhrGvvatgdgfyaeteaelrllrrlg..adaveMEtaavaqvArelgvpfaairvvsDlaaggada


                         -         -         -         +         -         -         -:280
query           IIEAGRRSAQVLLTFLKALD--------------------------------------------------
PF01048         eatheeveefaqeaakn-----------------------------------------------------