[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55245.1


[Show Plain Result]

## Summary of Sequence Search
   1::230
  12::214  PF03070 0.0% 29.5566502463054  TENA/THI-4/PQQC family 
   1::230


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
PF03070         -----------rpiwqkythHpFvqqlaegtlpkekfqaylkqdylylkayarvlailaskaedeelrre


                         -         -         *         -         -         -         -:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
PF03070         lvdeildnieseielhlrlaealGlsredlekiepspatkayvnylvelaktgswlealaAllpclivyn


                         +         -         -         -         -         *         -:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
PF03070         eiadrlkeklssptqkiyrewvsdyaseefeeaveeaeellnelleeysdskleelqeiflkvlefelsF


                         -         -         -         +         -         -         -:280
query           MAYQHQTWKSDLQSLEKGEE--------------------------------------------------
PF03070         wdma------------------------------------------------------------------