[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55303.1


[Show Plain Result]

## Summary of Sequence Search
   1::816
   8::162  PF00929 0.0% 36.1290322580645  Exonuclease 
 266::318  PF00270 0.0% 32.6923076923077  DEAD/DEAH box helicase 
 244::310  PF04851 0.0% 27.6923076923077  Type III restriction enzyme, res subunit 
   1::816


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKTIGNRYVVVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDVNPHEPLDAHIKELTGLTDQRLAQAP
PF00929         -------lvviDcEttgldaekdeiieiaavsivggeeeigetfdtyvkpeedakitdeateftgitqed
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
PF00929         ldkapsfeevleelkellrklkllvahnaafdvgfllqddlrflklempkrndvldtlildkktlkelkr
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGIPLKHAHTALSDAQATAELLLFLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDL
PF00929         tslkklaekllleeiqraHrAl------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VQVQGLYFKKTAASLELRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGY
PF00929         ----------------------------------------------------------------------
PF00270         -------------------------------------------------------vlvaaeTGsGKTlaf
PF04851         ---------------------------------klrpyQeeaienllesiekedekkrglivmaTGtGKT


                         -         *         -         -         -         -         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHSLQENDENRLF
PF00929         ----------------------------------------------------------------------
PF00270         lipvlqilyetlpnapkalivaPtreLaeqtlenlkkf--------------------------------
PF04851         lvaasliarlar..kflflvprkelleqal----------------------------------------


                         -         -         -         -         *         -         -:420
query           RRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVTEDFWKRSQERAETCKLLVTNH
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQETYDIQSIIDLIDKALVGEENRVQQRILESIRFE
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           CLYLIEQFQSGKSRKNILDSLDNLHQYFSELEVEGFDELVRYFTAEGDYWLEVTETSQKKIQISSTKSGR
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TLLSSLLPESCQVLGVSATLEISQRVSLADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYA
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           REVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWE
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           GVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIRLKQALGRSMRREYQRSL
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           TLILDRRIVGKRYGKQIVASLAEEATVKTISRSEVDEAIDRFFNEL------------------------
PF00929         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF04851         ----------------------------------------------------------------------