[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55344.1


[Show Plain Result]

## Summary of Sequence Search
   1::238
  16::230  PF00119 0.0% 34  ATP synthase A chain 
   1::238


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFVIGFTEPNIGS
PF00119         ---------------lnllsllmllllllilllvallttkklklvpsrlqsflelivdfvrnlvkdqige


                         -         -         *         -         -         -         -:140
query           RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
PF00119         kelqlfvpliltlflfilvsNllglipysft.........ptsdlsltlalalllwlatlllgiklkgls


                         +         -         -         -         -         *         -:210
query           KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
PF00119         gf.sllvppgtplalipflvlielisefarplslglRLfgNilAghllltllaslltv.slvvgilplli


                         -         -         -         +         -         -         -:280
query           VFISCIQAYVFTLLTSVYLGNKINIEEE------------------------------------------
PF00119         v....llltilelfvaiiQa--------------------------------------------------