[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55442.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
   1::76   PF03449 0.0% 55.4054054054054  domain 
  84::157  PF01272 0.0% 48.6486486486486  Transcription elongation factor, GreA/GreB, C-term 
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEKTYPMTLEEKEKLEKELEELKLVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
PF03449         meek.l.iTaegyeklkeeleeLkkverpeiikaiaeArelGDlsENaeYkaakeeqreieaRireLedr
PF01272         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
PF03449         Leraei----------------------------------------------------------------
PF01272         -------------edkVgfgatVtledldegeeetytiVgpdeadpdegkiSveSPlGkaLlgkkvGDtv


                         +         -         -         -         -         *         -:210
query           TIETPVGSYDVKILKVEKTA--------------------------------------------------
PF03449         ----------------------------------------------------------------------
PF01272         evkapdgkekyeIikie-----------------------------------------------------