[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55446.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
  18::361  PF07690 0.0% 27.1641791044776  Major Facilitator Superfamily 
 362::400  PF07690 0.0% 17.9487179487179  Major Facilitator Superfamily 
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSNRYIIAFAGVILHLMLGSTYAWSVYRNPIIEKTGWDQASVAFAFSLAIFCLGLSAAFMGRLVXKFGP
PF07690         -----------------alarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGr
PF07690         -----------------alarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGr


                         -         -         *         -         -         -         -:140
query           RVMGSLSAFLYAGGNILTGFAIDRQELWLLYLAYGILGGLGLGAGYITPVSTIIKWFPDKRGLATGLAIM
PF07690         rrvlllglllfalglllll.fa...sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgll
PF07690         rrvlllglllfalglllll.fa...sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgll


                         +         -         -         -         -         *         -:210
query           GFGFASLLTSPIAQHLIAGVGLVETFYILGASYFIIMLLASQFIKRPNEQELAILSASGKEKTDSLTQGM
PF07690         sagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkepaplv
PF07690         sagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkepaplv


                         -         -         -         +         -         -         -:280
query           TANQALKSNRFYILWIIFFINIACGLGLISAASPMAQEMAGLSTSHAAVMVGVLGIFNGFGRLLWASLSD
PF07690         p...awklllkppvlw.llialllf.ffvfsglltllplylqevlglspglllaglllgllaligaigal
PF07690         p...awklllkppvlw.llialllf.ffvfsglltllplylqevlglspglllaglllgllaligaigal


                         -         *         -         -         -         -         +:350
query           YIGRPLTFSILLLVNLLFSLSLWLFTDSVLFVVAMSILMTCYGAGFSLIPAYLSDIFGTKELAALHGYIL
PF07690         llgrlsdrlgrrrrlllallllllaalglallaftssavwllvvlvliGfglglvfptllalasdlappe
PF07690         llgrlsdrlgrrrrlllallllllaalglallaftssavwllvvlvliGfglglvfptllalasdlappe


                         -         -         -         -         *         -         -:420
query           TAWAMAGLAGPILLAETYKMAHSYTQTLFVFLILYSIALALSYYLGRSIKKESQKPLT------------
PF07690         erGtasglfntlylqevlglspglllaglllgllaligaigalllgrlsd--------------------
PF07690         erGtasglfntlylqevlglspglllaglllgllaligaigalllgrlsd--------------------