[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55485.1


[Show Plain Result]

## Summary of Sequence Search
   1::347
 162::318  PF00534 0.0% 27.4509803921569  Glycosyl transferases group 1 
   1::347


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKKKLRINMLSSSEKVAGQGVSGAYRELVRLLHRAAKDQLIVTENLPIEADVTHFHTIDFPYYLSTFQK
PF00534         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KRSGRKIGYVHFLPATLEGSLKIPFFLKGIVKRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIP
PF00534         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGM
PF00534         ---------------------klgknekkkiilsvgrlekeKgvdllikafallkeqenpnlklvivG..


                         -         -         -         +         -         -         -:280
query           TDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLY
PF00534         ..dgeeekelkklaeelelsdnvifvgevpredleelyrnadifvlpsrsEgfGivllEAmaaglpvias


                         -         *         -         -         -         -         +:350
query           KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKQAALGRK---
PF00534         nvggpaeivkdgvtGllvkpkdaealaeaiekllkdee--------------------------------