[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55561.1


[Show Plain Result]

## Summary of Sequence Search
   1::321
  23::104  PF00589 0.0% 24.2857142857143  Phage integrase family 
 154::310  PF00589 0.0% 33.5483870967742  Phage integrase family 
  55::125  PF02899 0.0% 34.2857142857143  Phage integrase, N-terminal SAM-like domain 
   1::321


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESKVTIIMQEMLPLLNNEQLLALRESLEHHLVDGKKQQKYSNNNLLQLFITAKQVEGCSSKTIRYYQRT
PF00589         ----------------------ellevlkeilsdrkkeaeere....llfvsk........rgkplsdst
PF00589         ----------------------ellevlkeilsdrkkeaeere....llfvsk........rgkplsdst
PF02899         ------------------------------------------------------lerglspnTvraYrrd


                         -         -         *         -         -         -         -:140
query           IENLFNAIKESVTQLTTDDLRSYLANYQSEKDCSKANLDNIRRILSSFFAWLEQEEYIIKNPIRRIKKIK
PF00589         vnrafkravkeagiekeltpHtLRhsfatalles------------------------------------
PF00589         vnrafkravkeagiekeltpHtLRhsfatalles------------------------------------
PF02899         Lkaflkflaergksaleqltaddvraflaellakg.lsaaslarrlsalrsffqf---------------


                         +         -         -         -         -         *         -:210
query           TEQNVKETYTDEHLEIMRDNCENLRDLAIIDLLASTGMRVGELVQLNRSDIDFENRECVVFGKGKKERPV
PF00589         -------------verllaaleeslsirdrllvellleTglRisEllslrvkdldldngtirvparetKt
PF00589         -------------verllaaleeslsirdrllvellleTglRisEllslrvkdldldngtirvparetKt
PF02899         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YFDARTKIHLRNYLNDRKDSHPALFVTLVGKAQRLGIAGVEIRLRKLGDKLGIQKVHPHKFRRTLATKAI
PF00589         kkertvplseellevlkeilsdrkkeaeerellfvsk..rgkplsdstvnrafkravkeagiekeltpHt
PF00589         kkertvplseellevlkeilsdrkkeaeerellfvsk..rgkplsdstvnrafkravkeagiekeltpHt
PF02899         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DKGMPIEQVQKLLGHSKIDTTLAYAMVNQNNVKHSHQKFIS-----------------------------
PF00589         LRhsfatallesGvdlkvvqkllGHssist----------------------------------------
PF00589         LRhsfatallesGvdlkvvqkllGHssist----------------------------------------
PF02899         ----------------------------------------------------------------------