[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55614.1


[Show Plain Result]

## Summary of Sequence Search
   1::226
 104::223  PF04002 0.0% 44.1666666666667  Protein of unknown function (DUF2466) 
   1::226


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
PF04002         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLNTQNQIIHQ
PF04002         ---------------------------------lkspedvaeylkeeladekqEefvvllldtknrliav


                         +         -         -         -         -         *         -:210
query           QTIFIGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
PF04002         eevseGtlnsasvhpReifkralkenaaavilaHnhPsgdpepSqaDielTkrlkealellgikllDhiI


                         -         -         -         +         -         -         -:280
query           VSHSNYFSYREKTDLI------------------------------------------------------
PF04002         vgkeeyfSfaeeg---------------------------------------------------------