[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55636.1


[Show Plain Result]

## Summary of Sequence Search
   1::232
   5::229  PF09922 0.0% 36.7713004484305  Predicted membrane protein (DUF2154) 
   1::232


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEGNNLLLVAATILFFFIVMLNPF
PF09922         ----siflligallllkalglilseegslfllllplllillgyyllkkrkfklgnvlliiglillllsll


                         -         -         *         -         -         -         -:140
query           VILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEVVTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGK
PF09922         sfnlvilllplaliylgikliskkkkeerakakirkeeeekekpsaetlkrnnwfGdqrtved..syefk


                         +         -         -         -         -         *         -:210
query           DTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYL
PF09922         diniqngiGdtvIDLskavlpegetvIvirkliGdvkilVPsdvevsldvsaifGgvdlfdeeeeglrne


                         -         -         -         +         -         -         -:280
query           KSNKSVKIFLTTMIGDVEVVRG------------------------------------------------
PF09922         slrvksedydeaerklkIv---------------------------------------------------