[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55668.1


[Show Plain Result]

## Summary of Sequence Search
   1::362
   7::348  PF00465 0.0% 30.3514376996805  Iron-containing alcohol dehydrogenase 
  18::317  PF01761 0.0% 24.4444444444444  3-dehydroquinate synthase 
   1::362


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVLALFNGEASDN
PF00465         ------Ptkivfgkgaleelgeelkklg.kvlivtdkslkklglldkvlesLkeagievtvfdgvepept
PF01761         -----------------leklsellkellkgkklvvvtdenvaklygekveellkeagievevlvlpege


                         -         -         *         -         -         -         -:140
query           EINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYL
PF00465         leeveeaaalareekadvivAvGGGsviDtAKaiallltnpgelldyegkakkkkkpalpliaiPTtaGt
PF01761         alktletleklldalleagltrksvlialGGGvigDlagfaAatylrGvrfiqvPTtllaqvDssvGgkt


                         +         -         -         -         -         *         -:210
query           FYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLF
PF00465         GsevtplavitdeegkrklsiaspkllPdlaivDpeltltlPkrvtaatglDalthalEayvskkanp..
PF01761         ainlpegk..nligafaqPkaVliDldvLktlperelraGlaEviKyglikdaelfelleeeeeaelaak


                         -         -         -         +         -         -         -:280
query           ADGLQAMAACEAKVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTL
PF00465         ................lsdalaeealrliaenlpravadp.edleareqmllastlAGlafsnaglgaaH
PF01761         ...........rdeealeelikrsieskaavvaaDekegglral...lnlgH.....tfgHalEallgy.


                         -         *         -         -         -         -         +:350
query           VQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQ
PF00465         alahalg....glfgipHGeavail.lpavlrfnaaaaperyarlaralgvdegsdeealaeelieal--
PF01761         ....gkllHGeaVaiGmvlaaklseklgllskeever---------------------------------


                         -         -         -         -         *         -         -:420
query           AIIAVDAYVNSK----------------------------------------------------------
PF00465         ----------------------------------------------------------------------
PF01761         ----------------------------------------------------------------------