[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55766.1


[Show Plain Result]

## Summary of Sequence Search
   1::532
 325::403  PF06580 0.0% 33.3333333333333  Histidine kinase 
 421::530  PF02518 0.0% 24.0384615384615  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
   1::532


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRESTQIAQALVENQARIEGIYKYFSLS
PF06580         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MPDYFYWQLERKASPYISVSLYENVDDLYVRNDFVTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAG
PF06580         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NSFAIPVSDPVSDQDLGVIYISLDPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHIGETVDKESENWLVG
PF06580         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LTSHGYQVQVAVPKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEXG
PF06580         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVM
PF06580         --------------------------------------------lkaLqsqinPHFlfNtLnsisslaee
PF02518         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           QSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT
PF06580         d.pekaeelieklsdllryslssskelvtLeeEleliknYlalqklrfgdrle-----------------
PF02518         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQ
PF06580         ----------------------------------------------------------------------
PF02518         lrqivselvdNavkateesgeievrvkreegelvieVeDnGiGipeedlervfepffqtdd...dsrkvg


                         *         -         -         -         -         +         -:560
query           RQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDE----------------------------
PF06580         ----------------------------------------------------------------------
PF02518         gtGlGlsivkklvellgge...ieveskeggGttvtlrlp------------------------------