[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55806.1


[Show Plain Result]

## Summary of Sequence Search
   1::234
  43::166  PF00005 0.0% 38.3928571428571  ABC transporter 
   1::234


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGK
PF00005         ------------------------------------------STLlklltgelkptegeievdndrkdle


                         -         -         *         -         -         -         -:140
query           KLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLGSLSG
PF00005         sdkleklrigyipqdpllf...peltvrenldmakeekk.........tdkrieevlekvgldelldksr


                         +         -         -         -         -         *         -:210
query           GQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELMHHSAHHHGKAVLMITHDPEEVKDYADRNIH
PF00005         vstLSgGqkqrvalArallkkpklll--------------------------------------------


                         -         -         -         +         -         -         -:280
query           LVRNQDSPWRCFNVHENGQEVGHA----------------------------------------------
PF00005         ----------------------------------------------------------------------