[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55904.1


[Show Plain Result]

## Summary of Sequence Search
   1::474
  13::469  PF00171 0.0% 41.6851441241685  Aldehyde dehydrogenase family 
   1::474


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEADEAMQAARAALPXWXALSAIERAAYLHKT
PF00171         ------------vesesetievinPatgeviakvaaataedvdaavaaAkaafkawaklpaeeRaeilrk


                         -         -         *         -         -         -         -:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
PF00171         aadlleerrdelaelevletGkplaearaevaeaidvlryyagaaeklegevlps.s.....egkkalvr


                         +         -         -         -         -         *         -:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
PF00171         rePlGvvaaitPWNfPlllaawklapalaaGNtvvlKpseetpltalllaelleeaglPkgvlnvvtgsg


                         -         -         -         +         -         -         -:280
query           EIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSG
PF00171         sevgealvehpdvdkvsftGstevgrkiakaaaknlkkvtlElGGkspliVledaDldkaveaivkgafl


                         -         *         -         -         -         -         +:350
query           QRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTP
PF00171         naGQvCiatsrllVhesiydefveklveaakklkvGdpldedtdlGPliskkqlervekyieeakeegak


                         -         -         -         -         *         -         -:420
query           IKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA
PF00171         lllGGeeekaglekgyfvePtvladvtpdmriaqeEiFGPVlsvikfkdeeeaielaNdteyGLaaavft


                         -         -         +         -         -         -         -:490
query           EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDVK----------------
PF00171         edleraervaerleaGnvwiNdsstgdaealpfgGvkqSglGreggkeg---------------------