[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55940.1


[Show Plain Result]

## Summary of Sequence Search
   1::203
 114::200  PF02517 0.0% 34.4827586206897  CAAX amino terminal protease family 
   1::203


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLLVTSLSVAYARKFEMISFGMLSKKQL
PF02517         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAEVSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDN
PF02517         -------------------------------------------illaaiiapviEElifRgllllllekk


                         +         -         -         -         -         *         -:210
query           SWLGLVLTSSLFSFMHGPSNVPSFIFYLLGGLLLGFAYKKSQNLWVSTLVHMLYNSWPLLYYL-------
PF02517         asgllaillsailfglvHvdtlqldsstliqilpafiaglifgylylrtkslwapilaHa----------