[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF55996.1


[Show Plain Result]

## Summary of Sequence Search
   1::798
 260::424  PF04851 0.0% 26.9736842105263  Type III restriction enzyme, res subunit 
 266::424  PF00270 0.0% 20.8333333333333  DEAD/DEAH box helicase 
 331::366  PF00271 0.0% 33.3333333333333  Helicase conserved C-terminal domain 
 583::656  PF00271 0.0% 32.258064516129  Helicase conserved C-terminal domain 
   1::798


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEEMEQDLKD
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKILYPLEGLSQEERVRLFGSEDS
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LAFSSLDLGKQAEMMRLTRKGLLGLEYQAVDQKKVKTQSWYEVDHAQLEGVEISTRAKKKLELRDYLLSH
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PESASLASLLESYSREQVNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSS
PF04851         -------------------------------------------------lklrpyQeeaienllesieke
PF00270         -------------------------------------------------------Qaeaiplile.....
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
PF04851         dekkrglivmaTGtGKTlvaasliarlar...kflflvprkelleqaleefkkfeskkiefekkniavak
PF00270         ggdvlvaaeTGsGKTlaflipvlqilyetlpnapkalivaPtreLaeqtlenlkkfkkylklrvlliigg
PF00271         --------------------------------------------------ekkgikvailhgelpqnere
PF00271         --------------------------------------------------ekkgikvailhgelpqnere


                         -         -         -         -         *         -         -:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
PF04851         kdklfgeeqkkskdkeekkkkdkeiilttiqklhkaleeeeendeskseslealldefdviiiDEaHrls
PF00270         vsardqlsvlng.....vdivvgtpgrlddllstgklnlsqvrflvlDEadrll.sq..gfsddinri..
PF00271         eileqFnagkskvlva------------------------------------------------------
PF00271         eileqFnagkskvlva------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVV
PF04851         akkk------------------------------------------------------------------
PF00270         lnql------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQ
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTA
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------elpqnereeileqFnagkskvlvatnvaerGidlpdvnlVinfdl...
PF00271         ----------------------elpqnereeileqFnagkskvlvatnvaerGidlpdvnlVinfdl...


                         -         +         -         -         -         -         *:700
query           LNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPP
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         .........prsvtsyiQriGRagRa--------------------------------------------
PF00271         .........prsvtsyiQriGRagRa--------------------------------------------


                         -         -         -         -         +         -         -:770
query           YYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPT
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LNQVLALTQERENSELRLSIDHEPQQFL------------------------------------------
PF04851         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------