[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56022.1


[Show Plain Result]

## Summary of Sequence Search
   1::424
 149::417  PF09903 0.0% 54.5454545454545  Uncharacterized protein conserved in bacteria (DUF2 
 343::407  PF04048 0.0% 16.9230769230769  Sec8 exocyst complex component specific domain 
   1::424


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNEIKCPNCGEVFTVNESQYAELLSQVRTTEFDKELHDRMRQELALAEQKAMNEQQTKLAQKDQEIAQLQ
PF09903         ----------------------------------------------------------------------
PF04048         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQLATLRLEHENQLQKTLSDLEKERNQVKNQLLL
PF09903         ----------------------------------------------------------------------
PF04048         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QEKENELSLASVKQNYEAQLKAASEQVEFYKNFKAQQSTKAIGESLEQYAESEFNKVRSFAFPNAYFEKD
PF09903         --------lklkvkekeeeikkleeqieelkrkkeqgstklqGEelEqhcenef..llaaaFptdlfekd
PF04048         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NKVSSRGSKGDFIFRECDENGVEIISIMFEMKNEADGTEKKHKNADFYKELDKDRREKNCEYAVLVTMLE
PF09903         nk.aeegsKgDyifrvfdeekqeigsimfEmKneldetrtkkknedflkkLdkDrrekkaeyAvLVsele
PF04048         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ADNDYFNTGIVDVSHEYEKMYVVRPQFFIQLIGLLRNAALNSLKYKQELALVREQNIDITHFEEDLDAFK
PF09903         pe..lynsgivdvseeykkvyvvrpqffiplitlLrnaaiksleikkeqenvkdknelienfekeleefl
PF04048         --------------------------------------------------------------ekaLqevv


                         -         -         -         -         *         -         -:420
query           LAFAKNYNSASTNFGKAIDEIDKAIKRMEEVKKFLTTSENQLRLANNKLEDVSVKKLTRKNPTMKAKFEA
PF09903         eaivknfesaskklekeikeidKaikklekqkekvlestknLrlannkiagltikkitsleltmkek---
PF04048         nehhqgfnssigsYskilssitesqekirelKesleeakkklstrkkeLkeLnaesa-------------


                         -         -         +         -         -         -         -:490
query           LKGE------------------------------------------------------------------
PF09903         ----------------------------------------------------------------------
PF04048         ----------------------------------------------------------------------