[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56069.1


[Show Plain Result]

## Summary of Sequence Search
   1::335
   2::277  PF00365 0.0% 61.9565217391304  Phosphofructokinase 
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
PF00365         -kkiavltsGGDapGmnaavravvrsaiakGlevfvireGyeGlvegeikklevesvsdiiqrgGtilgs


                         -         -         *         -         -         -         -:140
query           ARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
PF00365         arlkefkeeegrkkaiekLkkagidalvviGGDGsltGakllteehglnivglvGtiDnDlsgtDatiGf


                         +         -         -         -         -         *         -:210
query           TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
PF00365         dtalervveaiDkirdtasshervfvvevmGrhcgdlalvagiaggadvivipeaekseeelverlkksr


                         -         -         -         +         -         -         -:280
query           CGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGI
PF00365         ergkrsaivivaegvidlkaitseavkklkkerlgldtrvtvLGhvqrGGtptafDrilasrlgaea---


                         -         *         -         -         -         -         +:350
query           GGVAVGIRNEKMVENPILGTAEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS---------------
PF00365         ----------------------------------------------------------------------