[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56087.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
 139::273  PF03193 0.0% 51.8518518518519  Protein of unknown function, DUF258 
  73::119  PF00009 0.0% 27.2727272727273  Elongation factor Tu GTP binding domain 
 153::175  PF00009 0.0% 26.0869565217391  Elongation factor Tu GTP binding domain 
 161::212  PF01926 0.0% 26.530612244898  GTPase of unknown function 
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
PF03193         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSK
PF03193         --------------------------------------------------------------------gl
PF00009         --lDgavlvvdaveG..vepqteevlrlakklgvkiivviNKiDrvd.e---------------------
PF00009         --lDgavlvvdaveG..vepqteevlrlakklgvkiivviNKiDrvd.e---------------------
PF01926         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
PF03193         eelaellkdktsvlvGqSGvGKSsLinallpeldlkvgevseklgrGkhTTtavellklsegglliDtPG
PF00009         ------------giighvDhGKtTltdallykaga-----------------------------------
PF00009         ------------giighvDhGKtTltdallykaga-----------------------------------
PF01926         --------------------GKStLinaltgk...akakvanypgtTrdpnegkvkledgkeitliDtpG


                         -         -         -         +         -         -         -:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
PF03193         frelelekvekeelaelFpeirklaekCkfrdClHlkepgCavkeaveegeiseeryesylkl-------
PF00009         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF01926         ii--------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ETYKKVSKKIPK----------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------