[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56119.1


[Show Plain Result]

## Summary of Sequence Search
   1::109
   4::107  PF02537 0.0% 46.1538461538462  CrcB-like protein 
   1::109


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTT
PF02537         ---llvalggalGallRyllsellkkkvkkaplgtllvNvlGsfllgllvallaaeraskvskelrlllg


                         -         -         *         -         -         -         -:140
query           FSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL-------------------------------
PF02537         tGflGglTTfStfalelvkllesgkilkallylllsl---------------------------------