[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56127.1


[Show Plain Result]

## Summary of Sequence Search
   1::555
  34::198  PF02734 0.0% 38.8888888888889  DAK2 domain 
   1::555


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTIENGAKEVADKPASTVGEVASIL
PF02734         ---------------------------------pvGDGDtGtnmargaeavlkaleeleeeadlaevlka


                         -         -         *         -         -         -         -:140
query           AKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAI
PF02734         iakallskagGtsGvlysqflraaakalkekeeldaeelakaleaal.eaikavGkakpgdkTmlDvlrp


                         +         -         -         -         -         *         -:210
query           GAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASED
PF02734         avealea.akd.edleealeaaakaaekgaeaTkellaklgrAsylgerslgvvDpGA------------


                         -         -         -         +         -         -         -:280
query           FVATPANMSEMINVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVV
PF02734         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NDDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEYALIAVVAGKG
PF02734         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART
PF02734         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTTAVRDTTIDGLEIHENDNLGMVDGKILVSNPDM
PF02734         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           HQTLTETLKHMLDEDSEIVTFYVGEDGSEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE-----
PF02734         ----------------------------------------------------------------------