[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56181.1


[Show Plain Result]

## Summary of Sequence Search
   1::358
 137::328  PF02774 0.0% 40.7821229050279  Semialdehyde dehydrogenase, dimerisation domain 
   4::118  PF01118 0.0% 38.5964912280702  Semialdehyde dehydrogenase, NAD binding domain 
   4::95   PF01113 0.0% 27.4725274725275  Dihydrodipicolinate reductase, N-terminus 
 101::138  PF02800 0.0% 27.027027027027  Glyceraldehyde 3-phosphate dehydrogenase, C-termina 
 225::314  PF02800 0.0% 17.6470588235294  Glyceraldehyde 3-phosphate dehydrogenase, C-termina 
   1::358


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALF
PF02774         ----------------------------------------------------------------------
PF01118         ---kvaivGatGyvGqellrlLee.hpelelvalvassrsaGkklaeahkaleegkdlvledadeeelke
PF01113         ---kvavvGasGrmGkevikaieeaedlelvaavdrkeselegkdagellglgklgvavtddleevleka
PF02800         ----------------------------------------------------------------------
PF02800         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
PF02774         ------------------------------------------------------------------LkPL
PF01118         vdivflalpagvskelapklleagvkviDlssafRldddapyglpevn----------------------
PF01113         dvliDFTtpeav.lenlklalekgv---------------------------------------------
PF02800         ------------------------------akavgkVlpelk.gkltgmAlrVPtpdvsvvdlvvele--
PF02800         ------------------------------akavgkVlpelk.gkltgmAlrVPtpdvsvvdlvvele--


                         +         -         -         -         -         *         -:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
PF02774         ldalgelervivatyqavSGaGkkgvreLlkq...........vaelqrsdeakpgvfgvpiagNlipyi
PF01118         ----------------------------------------------------------------------
PF01113         ----------------------------------------------------------------------
PF02800         ----------------------------------------------------------------------
PF02800         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VFTDNDYTYEEMKMTKETKKIMEDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
PF02774         dkeedkgepetreelkavaetkkilefte.kvsatcvrVPvlrGhseavtiklklkdveveeveellaaa
PF01118         ----------------------------------------------------------------------
PF01113         ----------------------------------------------------------------------
PF02800         --------------akavgkVlpelkgkltgmAlrVPtpdvsvvdlvvelekkvtveevnaalkeaae..
PF02800         --------------akavgkVlpelkgkltgmAlrVPtpdvsvvdlvvelekkvtveevnaalkeaae..


                         -         *         -         -         -         -         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
PF02774         pevkvvvne.eedrPtpaavaggtnsvsVGRirkdemgdeglklvvvg----------------------
PF01118         ----------------------------------------------------------------------
PF01113         ----------------------------------------------------------------------
PF02800         ...galkgilsyteeelvssDfvgdphssifdak------------------------------------
PF02800         ...galkgilsyteeelvssDfvgdphssifdak------------------------------------


                         -         -         -         -         *         -         -:420
query           AELKFELK--------------------------------------------------------------
PF02774         ----------------------------------------------------------------------
PF01118         ----------------------------------------------------------------------
PF01113         ----------------------------------------------------------------------
PF02800         ----------------------------------------------------------------------
PF02800         ----------------------------------------------------------------------