[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56217.1


[Show Plain Result]

## Summary of Sequence Search
   1::581
  19::291  PF00664 0.0% 24.7232472324723  ABC transporter transmembrane region 
 257::303  PF00005 0.0% 31.8181818181818  ABC transporter 
 375::497  PF00005 0.0% 31.5315315315315  ABC transporter 
 366::402  PF06414 0.0% 41.6666666666667  Zeta toxin 
 336::392  PF03193 0.0% 37.5  Protein of unknown function, DUF258 
 364::379  PF02463 0.0% 37.5  RecF/RecN/SMC N terminal domain 
 453::539  PF02463 0.0% 27.1428571428571  RecF/RecN/SMC N terminal domain 
   1::581


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGQLTQQDLLLSLFYLLLAAFGM
PF00664         ------------------llailllilagvtalvfplllgrlldsvsdgndeersslyslailliavgvl
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVD
PF00664         .ivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvskirdglgdklglf
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVT
PF00664         f.qslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEalsgir
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTF
PF00664         tVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgelsvgtv
PF00005         ----------------------------------------------Llklltgelkptegeievdndrkd
PF00005         ----------------------------------------------Llklltgelkptegeievdndrkd
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEET
PF00664         faflslglqls-----------------------------------------------------------
PF00005         les.dkleklr..igyipqdpll-----------------------------------------------
PF00005         les.dkleklr..igyipqdpll-----------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03193         -------------------------------------------------------lgyevlvlsvktkeg
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LTDIHFSLAKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
PF00664         ----------------------------------------------------------------------
PF00005         ------------------------STLlklltgelkptegeievdndrkdlesdkleklr..igyipqdp
PF00005         ------------------------STLlklltgelkptegeievdndrkdlesdkleklr..igyipqdp
PF06414         ---------------lgGqpGAGKtslaellleela.agnivridaDelrky------------------
PF03193         leelaellkd.ktsvlvGqSGvGKSsLinallpeldlkvgev----------------------------
PF02463         -------------taivGpNGSGKsnvld-----------------------------------------
PF02463         -------------taivGpNGSGKsnvld-----------------------------------------


                         -         -         +         -         -         -         -:490
query           FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEP
PF00664         ----------------------------------------------------------------------
PF00005         llfpeltvrenldmakeekk.........tdkrieevlekvglde.lldksrvstLSgGqkqrvalAral
PF00005         llfpeltvrenldmakeekk.........tdkrieevlekvglde.lldksrvstLSgGqkqrvalAral
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         --------------------------------e.................lLSgGektLvalaLlfAiqk
PF02463         --------------------------------e.................lLSgGektLvalaLlfAiqk


                         *         -         -         -         -         +         -:560
query           DILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGRHEDLLALD
PF00664         ----------------------------------------------------------------------
PF00005         lkkpkll---------------------------------------------------------------
PF00005         lkkpkll---------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         vkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlek---------------------
PF02463         vkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlek---------------------


                         -         -         -         *         -         -         -:630
query           GWYAQTYQSQQLEMKGEEDAE-------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------