[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56317.1


[Show Plain Result]

## Summary of Sequence Search
   1::514
   9::265  PF00009 0.0% 37.8531073446328  Elongation factor Tu GTP binding domain 
 303::369  PF03144 0.0% 29.8507462686567  Elongation factor Tu domain 2 
  14::142  PF08477 0.0% 23.4234234234234  Miro-like protein 
   1::514


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSS
PF00009         --------kirnigiighvDhGKtTltdallykagaiskrgeeaeaerl....ldklkeerergiTiksa
PF03144         ----------------------------------------------------------------------
PF08477         -------------vvvGdkgvGKssllsqlvgeefp..................kkklpeeikgdtlavk


                         -         -         *         -         -         -         -:140
query           VMQFDYDGKRVNXLDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQTXKLFEVVKHRGIPVFTFMNK
PF00009         aisleletkkrlinliDtPGHvdFskevirglrvlDgavlvvdaveGvepqteevlrlakklgvkiivvi
PF03144         ----------------------------------------------------------------------
PF08477         tlevdvdtellelwdlggreelkkehelllkkadaillvydltdeesleevsellawlaelrklgkkipv


                         +         -         -         -         -         *         -:210
query           LDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNP
PF00009         NKiDrvdeaeleevveelkekl................................................
PF03144         ----------------------------------------------------------------------
PF08477         il--------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDP
PF00009         ......................lekylekge......eevpvipgSalkglgida---------------
PF03144         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVA
PF00009         ----------------------------------------------------------------------
PF03144         ----------------------tvatgrvysGtlkkGdtvrilgndtskkeivtrvrsletfngdldeav
PF08477         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN
PF00009         ----------------------------------------------------------------------
PF03144         aganaGvivaikgledaii---------------------------------------------------
PF08477         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXLAKDRFDQPVF
PF00009         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LFENDFALRWFADKYPDVELEEKM----------------------------------------------
PF00009         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------