[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56337.1


[Show Plain Result]

## Summary of Sequence Search
   1::269
   7::104  PF01418 0.0% 28.125  Helix-turn-helix domain, rpiR family 
 120::224  PF01380 0.0% 24.7619047619048  SIS domain 
   1::269


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLLQKELIPMIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
PF01418         ------llekieskkekltksekkiaeyilaspdnaialsiaelAkaagvSeasvvrfakkLGfkGFsel
PF01380         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSSVLALQE
PF01418         kvalakelaqkk..esileseiaeddsleaiaek------------------------------------
PF01380         -------------------------------------------------lskakriylvGaGtsyaiAle


                         +         -         -         -         -         *         -:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRKFDE
PF01418         ----------------------------------------------------------------------
PF01380         lalkleeiggivvevedaselrhgplalvdpddlvilisqsgetkelveaaellkergakiiaitdsans


                         -         -         -         +         -         -         -:280
query           EDCFFDELLLLASTDHLSYGNRISPQFPILLITDCLFSNYLESPERQYYYNQTIIHKEE-----------
PF01418         ----------------------------------------------------------------------
PF01380         plareadltlyina--------------------------------------------------------