[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56378.1


[Show Plain Result]

## Summary of Sequence Search
   1::210
  41::163  PF00005 0.0% 38.7931034482759  ABC transporter 
  27::47   PF02463 0.0% 33.3333333333333  RecF/RecN/SMC N terminal domain 
  95::206  PF02463 0.0% 31.5068493150685  RecF/RecN/SMC N terminal domain 
   8::48   PF03193 0.0% 30  Protein of unknown function, DUF258 
   1::210


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS
PF00005         ----------------------------------------STLlklltgelkptegeievd.ndrkdles
PF02463         --------------------------ksftaivGpNGSGKsnvldAi-----------------------
PF02463         --------------------------ksftaivGpNGSGKsnvldAi-----------------------
PF03193         -------vlsvktkegleelaellkd.ktsvlvGqSGvGKSsLinall----------------------


                         -         -         *         -         -         -         -:140
query           DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES
PF00005         dkleklrigyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvglde.lldksrvstLSgG
PF02463         ------------------------e......................................lLSgGek
PF02463         ------------------------e......................................lLSgGek
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDHLK
PF00005         qkqrvalArallkkpklllLDEP-----------------------------------------------
PF02463         tLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivi.slreemlekadk----
PF02463         tLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivi.slreemlekadk----
PF03193         ----------------------------------------------------------------------