[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56413.1


[Show Plain Result]

## Summary of Sequence Search
   1::240
  62::195  PF00849 0.0% 28.3582089552239  RNA pseudouridylate synthase 
   1::42   PF01479 0.0% 38.0952380952381  S4 domain 
   1::240


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKG
PF00849         -------------------------------------------------------------lvvvnKPag
PF01479         rRLDkvLarlglassrseArqlIehGhVrVNGkvvkdpsyrV----------------------------


                         -         -         *         -         -         -         -:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
PF00849         vpvtpeakggsekeksttatssraeeekkelklvhRLDkaTsGllllAksgeaaaklakafeerkvrKkY
PF01479         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTM
PF00849         lalvfgapleeegaikskiskdtekqegarrkkeeldgkkavtylrvlesgsktp---------------
PF01479         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GTLVLDENLERGEWRRLTKEELEILRANII----------------------------------------
PF00849         ----------------------------------------------------------------------
PF01479         ----------------------------------------------------------------------