[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56432.1


[Show Plain Result]

## Summary of Sequence Search
   1::652
  76::519  PF00496 0.0% 26.7955801104972  Bacterial extracellular solute-binding proteins, fa 
   1::652


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKSKSKYLTLAGLVLGTGVLLSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
PF00496         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
PF00496         -----vvpaLAeswwevsddgktytfkLRkgvkfsDGt.....pltAdDvvfslerladpdtasgaasll


                         +         -         -         -         -         *         -:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
PF00496         a..............qdivgveavddytvrftlkkpna.....lflpllaavaaaiakkakkeddasktl


                         -         -         -         +         -         -         -:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
PF00496         aekpvgtGPYklksfkpgqkivlerNpdYWgggkpkldriefrvi..pdadaaaaalqsGeiddvaevpp


                         -         *         -         -         -         -         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
PF00496         gdlaalkekpgldv..larspgggvtylafNtk..................kppfddkrvRqAlayAiDr


                         -         -         -         -         *         -         -:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPEKAKAKFAEA
PF00496         eeivkavlgglatpansl.lppsspgynpyytkapp...........................dpakAkk


                         -         -         +         -         -         -         -:490
query           KKELEAKGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
PF00496         lLaeaGykdgdgggrrkk...kllltlllasgdptskaiaeaiqqqlkkiGikvevktvdwt.....aty


                         *         -         -         -         -         +         -:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKR
PF00496         laavaegdfdmallgwgadypdpdaflsp-----------------------------------------


                         -         -         -         *         -         -         -:630
query           YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYAKARE
PF00496         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KWLKEKEESNKKAQEELAKHVK------------------------------------------------
PF00496         ----------------------------------------------------------------------