[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56555.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
  15::361  PF07690 0.0% 21.0365853658537  Major Facilitator Superfamily 
   5::193  PF05977 0.0% 24.3243243243243  Bacterial protein of unknown function (DUF894) 
 265::317  PF05977 0.0% 29.4117647058824  Bacterial protein of unknown function (DUF894) 
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAILLITISETLPQVLQIFLGVLADFQH
PF07690         --------------laaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdr
PF05977         ----lrnkvFrvlWiaslvsnlgtliqeVaaaWlmtslsasplmValvqaaatLPifllsllaGvlaDnl
PF05977         ----lrnkvFrvlWiaslvsnlgtliqeVaaaWlmtslsasplmValvqaaatLPifllsllaGvlaDnl


                         -         -         *         -         -         -         -:140
query           HRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLVAFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAE
PF07690         .fGrrr.vlllglllfalg.lllllfasslwalllvlrv.....lqGlgagalfpagaaliadwfpkeer
PF05977         drRkvllvvqlllllasvlltvlaalgllspwlllaltfllgi....GaalnapaWqasvgelvkrddvp
PF05977         drRkvllvvqlllllasvlltvlaalgllspwlllaltfllgi....GaalnapaWqasvgelvkrddvp


                         +         -         -         -         -         *         -:210
query           AIGFKQSTVSLVKTISNILGGVLLGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTINYQEGLSVK
PF07690         gralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelr
PF05977         aAvaLnsvgvNiaRsvGPAlgGvlvaavgaalafavnalsylavivalarwkr-----------------
PF05977         aAvaLnsvgvNiaRsvGPAlgGvlvaavgaalafavnalsylavivalarwkr-----------------


                         -         -         -         +         -         -         -:280
query           SFCQHLLQSSKLIWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALI
PF07690         kepaplvp.awklllkppvlw....llialllfffvfsglltllpl...ylqevlglsp..glllaglll
PF05977         ------------------------------------------------------gRalsvYltvlaGgla
PF05977         ------------------------------------------------------gRalsvYltvlaGgla


                         -         *         -         -         -         -         +:350
query           VGSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQELVFKQIPXE
PF07690         gllaligaig.alllgrlsdrlgrrrrlllallllllaalglallaftssavwllvvlvliGfglglvfp
PF05977         aGsllWGtvaealslelaLllaav..alllgalllll---------------------------------
PF05977         aGsllWGtvaealslelaLllaav..alllgalllll---------------------------------


                         -         -         -         -         *         -         -:420
query           SMGAVQSSISAXTVVLPSLFTISLVTIATSFGTLAVSFVLLLFXLVAFVMLLNIRESI------------
PF07690         tllalasdlap-----------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------