[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56614.1


[Show Plain Result]

## Summary of Sequence Search
   1::195
  35::77   PF01476 0.0% 42.8571428571429  LysM domain 
   1::195


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIY
PF01476         ----------------------------------ytVkkGDTLwkIAsryglseqeltelNeeldspr.l


                         -         -         *         -         -         -         -:140
query           VDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSY
PF01476         avGqkLc---------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYGSWTAAKNFWLNNGWY---------------
PF01476         ----------------------------------------------------------------------