[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56631.1


[Show Plain Result]

## Summary of Sequence Search
   1::98
   7::73   PF08951 0.0% 26.865671641791  Enterocin A Immunity 
   1::98


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEPNLESLIKDLYNHARHDLSEDLVAALLETAKKLPTTNEQLQAVRLSGLVNRELLLNPKHPAPELLNL
PF08951         ------lndlyellndlninaneelrelLlkaakklekgkdvplvanrLvndlssyalakkihlskeqed


                         -         -         *         -         -         -         -:140
query           ARFIKREEAKYRGTATSALMYEELFKML------------------------------------------
PF08951         lyk-------------------------------------------------------------------