[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56657.1


[Show Plain Result]

## Summary of Sequence Search
   1::189
   5::165  PF04079 0.0% 51.2658227848101  Putative transcriptional regulators (Ypuh-like) 
   1::189


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
PF04079         ----aiiEAiLfvagep.lsleelaeile.seeeveealeeLkeey.eeedrglelvevaggyrlqtkpe


                         -         -         *         -         -         -         -:140
query           FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
PF04079         laelvkklvkekketrLsqaaletLaiIaykqpvtraeieeirGvnsdsvvktLlergLikekgrkeepg


                         +         -         -         -         -         *         -:210
query           RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ---------------------
PF04079         rpilYgtTekFleyfglksleeLpk---------------------------------------------