[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56666.1


[Show Plain Result]

## Summary of Sequence Search
   1::480
   4::290  PF02934 0.0% 53.3101045296167  GatB/GatE catalytic domain 
 327::474  PF02637 0.0% 42.5675675675676  GatB domain 
   1::480


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
PF02934         ---elviGlEiHvqLktktKlFcsckteaeeepntrvapvelglpgalPvlnkeavelavklalalncei
PF02637         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
PF02934         aeeskfdRKnyfypdlpkgyQitqlekpiaenGkleleveegeekririerihlEeDaaksvhekeeake
PF02637         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTK
PF02934         slvdlnRagvpLiEivtePdirspeearafleklreilrslgvsdaeleeGslRvDvNvSirkkgeeklg
PF02637         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLF
PF02934         trvEiKnlnslksiekaieyEierqvelleegekveqeTrkwdedkgktvvmRskeeaadYryfpepdlp
PF02637         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEV
PF02934         pieiseelle------------------------------------------------------------
PF02637         ----------------------------------------------dffeevvkegadpklaanwllvel


                         -         -         -         -         *         -         -:420
query           AQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
PF02934         ----------------------------------------------------------------------
PF02637         lgelnkegleieeskltpeqlaellkliaegkiskkiakevleelleepgkspeeiieekgLkqisdeee


                         -         -         +         -         -         -         -:490
query           IPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN----------
PF02934         ----------------------------------------------------------------------
PF02637         leklveeviaenpkavedyksgkekalgflvGqvMkktkGkadpklvnellkek----------------