[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56676.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
   9::363  PF01053 0.0% 51.830985915493  Cys/Met metabolism PLP-dependent enzyme 
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKELHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
PF01053         --------tlavhagqekdeaqtgavvvpiyatstykfksveeaalfageekgyeYsRsgnPtrevleer


                         -         -         *         -         -         -         -:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
PF01053         iaaLeggeaalavsSGmaAiaaallallkaGdevvatddlYggtqrllekvlkklgvevkfvdtsdleel


                         +         -         -         -         -         *         -:210
query           YIETPTNPLMLEFDIEKLAKLAHAKGAKVVVDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
PF01053         ekaikpntklvylEtptnpllkvvDieaiaklakkkgdvlvvvDntfaspllqrpLelgaDivvhSaTKy


                         -         -         -         +         -         -         -:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
PF01053         lnGhsdvvgGvvvvkgkeelakklkflqnalGavlspfdawlllrGlkTLslRverhsenAlklAefLek


                         -         *         -         -         -         -         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
PF01053         hpkvekvyYpgLeshpqhelakkqlkgfggvlsfelkseeeaakkfldklklfslaeslGgvesLishpa


                         -         -         -         -         *         -         -:420
query           ARDLIADLRQALEG--------------------------------------------------------
PF01053         tmthasipkeere---------------------------------------------------------