[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56680.1


[Show Plain Result]

## Summary of Sequence Search
   1::186
   3::181  PF04011 0.0% 50.2793296089385  LemA family 
   1::186


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTWIILGVLALVVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVA
PF04011         --aiilalvlvvlallavvsyNrlvklkeevkeawseievqlqrRaDlipnLvetvKgyashEkevLekv


                         -         -         *         -         -         -         -:140
query           ELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVV
PF04011         teaRakvatlsdaetvqkfqkaqaelssalsrllvvaEnYPdLkanenfleLqsqlegtEnrIavaRrkY


                         +         -         -         -         -         *         -:210
query           SNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGD------------------------
PF04011         neavqeyNvkieqFpsvivAklfgfkekelfqaeeaaeeap-----------------------------