[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56707.1


[Show Plain Result]

## Summary of Sequence Search
   1::289
  21::232  PF02896 0.0% 22.0588235294118  PEP-utilising enzyme, TIM barrel domain 
   1::289


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLYSDEEVWYRFT
PF02896         --------------------aeGiGLlRtEflfmdrde..lpteee.qaeay.kavlealngrpvvvRtl


                         -         -         *         -         -         -         -:140
query           ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
PF02896         Diggd..kelpelveepeevNPmlGfRgirlalsepelfetqlrAilrasaeg.kleimlPlvatveelr


                         +         -         -         -         -         *         -:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
PF02896         eakkvieevkeevekeglkvdkeikvGiMiEipsaalladklake.vdFfSiGtNDLtQytlavdRddee


                         -         -         -         +         -         -         -:280
query           LRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRS
PF02896         vaklydplepavlrlvkevika------------------------------------------------


                         -         *         -         -         -         -         +:350
query           THDTARNVE-------------------------------------------------------------
PF02896         ----------------------------------------------------------------------